KEGG   Novosphingobium pentaromativorans: JI59_17690Help
Entry
JI59_17690        CDS       T03399                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00071  Fatty acid degradation
npn00072  Synthesis and degradation of ketone bodies
npn00280  Valine, leucine and isoleucine degradation
npn00310  Lysine degradation
npn00362  Benzoate degradation
npn00380  Tryptophan metabolism
npn00620  Pyruvate metabolism
npn00630  Glyoxylate and dicarboxylate metabolism
npn00640  Propanoate metabolism
npn00650  Butanoate metabolism
npn00900  Terpenoid backbone biosynthesis
npn01100  Metabolic pathways
npn01110  Biosynthesis of secondary metabolites
npn01120  Microbial metabolism in diverse environments
npn01130  Biosynthesis of antibiotics
npn01200  Carbon metabolism
npn01212  Fatty acid metabolism
npn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:npn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JI59_17690
   00630 Glyoxylate and dicarboxylate metabolism
    JI59_17690
   00640 Propanoate metabolism
    JI59_17690
   00650 Butanoate metabolism
    JI59_17690
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JI59_17690
   00072 Synthesis and degradation of ketone bodies
    JI59_17690
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JI59_17690
   00310 Lysine degradation
    JI59_17690
   00380 Tryptophan metabolism
    JI59_17690
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JI59_17690
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JI59_17690
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JI59_17690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npn04147]
    JI59_17690
Enzymes [BR:npn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JI59_17690
Exosome [BR:npn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JI59_17690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIT81476
UniProt: G6E810
Position
3649198..3650355
Genome map
AA seq 385 aa AA seqDB search
MAEAYIVDAVRSAGGRRNGALSHVHPADLAGDVLSALVARTGIDPTSVEDVVLGCVTQVG
EQSFAFARNAVLASTLPETVPAVTVDRQCGSSQQAVQFAAQAVMSGTQDVVIAAGAESMS
RVPMLSNQQGVGTGPISDRIRKRFGVEGFSQFEGAEMMARKYGYSRETLDRFALHSHELA
AKAIALGAFDEEIVPITVETPDGTLQHSVDEGVRADSSLEKLGALKTLTEGGVITAGNAS
QICDGASAVLVVSERALKAHGLVPLARIHAMTVTGGDPVIMLEEPIAATQKLLERAGMAI
GDIDLYEVNEAFAPVPLAWLEVLGGDAERLNVHGGSIALGHPLGSSGTKLMATLVHALRR
HGKRYGLQTMCEAGGIANAMIVEAL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcctatatcgtcgatgccgtgcgcagtgcgggcggtcgtcgcaacggcgca
ctttcccatgtgcatccggccgatctggcaggcgatgtcctgtccgcgctggttgcgcgc
acggggatcgatccgacttcggttgaggatgtggtgctgggctgcgtcacgcaagttggt
gaacagtccttcgcttttgctcgcaatgccgtgcttgcctcgaccttgcccgaaacggtg
ccggccgtgaccgtcgaccgccagtgcggcagttcgcaacaagcggtgcaattcgcggcg
caggcggtgatgtccggcacgcaggatgtggtgatcgcggctggcgcggaaagcatgtcg
cgcgtgccgatgctgtccaatcagcaaggcgtcgggacagggccgataagcgaccgaatc
cgaaagcgatttggcgtcgaggggttcagccagttcgagggcgccgagatgatggcgcgc
aaatacggctactcgcgcgagacgttggaccgctttgcgctgcacagccacgaacttgcg
gcaaaagcgattgctcttggcgcgttcgatgaagaaatcgtaccgattaccgtcgaaacg
ccggatgggacacttcagcattcggtggacgagggcgtgcgtgccgattcctcgctggag
aagctcggcgccctcaaaacgctgacagagggcggcgtgatcacggccggcaatgccagc
cagatatgcgacggcgcctcggcggttcttgttgtcagcgaacgcgcgctcaaggcgcac
ggcctcgttccattggcgcgtatccatgccatgacggtgactgggggcgatcccgtaatc
atgctggaagaacccatcgccgcgacacagaaattgctggaacgcgcgggaatggcgata
ggcgatatcgacctttatgaagtgaatgaggcctttgcgccggtgcctctggcctggctg
gaggttttggggggagatgcagagcgcctcaacgtgcatggtggctctatcgctctgggt
caccctctcggctcatcgggaacgaaactgatggcgacgctggttcacgcgctacggcgt
cacggcaagcgatatggtctgcagacgatgtgcgaggcgggcggcattgccaatgcgatg
atcgtcgaagccctttga

DBGET integrated database retrieval system