KEGG   Novosphingobium pentaromativorans: JI59_21740Help
Entry
JI59_21740        CDS       T03399                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00626  Naphthalene degradation
npn01100  Metabolic pathways
npn01120  Microbial metabolism in diverse environments
npn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    JI59_21740
Enzymes [BR:npn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     JI59_21740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS DeoC
Motif
Other DBs
NCBI-ProteinID: AIT82152
UniProt: G6EGM2
Position
pLA3:complement(503537..504538)
Genome map
AA seq 333 aa AA seqDB search
MTKSPGLLTIDEITGAWAMLPSPATPNGWDWRETDTVDVDEVARATEAMISSGIDGLMGM
GTLGECCTMTREERRKFMSTAIDTAAGRVPFIAGATSLGTRDTIEMAREASDMGANGVLL
GLPMWCPADTSMAVSYFRDVAEACPDTTIFIYANFAAFRYTWPPAFWAQMADIPQVRGVK
YAAGANNRLVNDLNASRGNIRFLVMDMEYYMSARIDPDAMKAFWSSGAACGPEVATHLRD
LVEGAKASGDWSKAKEFSDRIAPSMATLFPRGQHTEFAKYNVGLEKERINAGGWMNVGPA
RPPHHLTPEEYLEGARTSGRIWAQIAEEITAAG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatctcctggactgctgacgatcgacgaaattaccggcgcttgggcgatgctg
ccttcgccggccacgcccaatggctgggactggcgcgaaacggacaccgtcgatgtcgac
gaggtcgcacgcgcgaccgaggcgatgatctcatcaggcatcgatggcctcatgggcatg
ggtacgcttggagaatgctgcaccatgacccgcgaggagcggcgaaagttcatgtccacc
gctatcgatacggcggcgggcagggtgccgttcattgccggcgccaccagcctcggcacg
cgcgataccattgaaatggcgcgcgaggcgagcgacatgggggcgaacggcgtcctgttg
ggcctgccgatgtggtgccctgccgacacctccatggcagtcagctattttcgggatgtc
gcagaggcctgtcccgatacgacgatcttcatctatgccaatttcgcggcgttccgctac
acgtggccccctgcattctgggcgcagatggccgatattccgcaggtcaggggcgtgaag
tatgccgccggggcgaacaatcggctggtcaacgatctcaatgcgtcgcgaggcaatatc
cgtttcctggtgatggacatggaatattacatgagcgcgcggatcgatcccgatgcgatg
aaggccttctggtcgagcggtgcagcttgtgggcccgaggtcgcgacgcatctgcgcgat
ctggtcgaaggcgcgaaagcgtccggcgactggagcaaggccaaggaattttccgaccgg
atcgcaccatcgatggcgaccttgttcccgcgtgggcaacataccgagttcgccaagtac
aacgttggcctcgagaaggagcgcattaacgcgggaggctggatgaacgtcgggccggct
cgtcctccccatcacctgacgcccgaggaatacctcgaaggcgcgcgtacttcaggccga
atctgggcacagatcgccgaagaaatcacggcggcaggttga

DBGET integrated database retrieval system