KEGG   Novosphingobium pentaromativorans: JI59_21910
Entry
JI59_21910        CDS       T03399                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00626  Naphthalene degradation
npn01100  Metabolic pathways
npn01120  Microbial metabolism in diverse environments
npn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    JI59_21910
Enzymes [BR:npn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     JI59_21910
SSDB
Motif
Pfam: DHDPS CutC
Other DBs
NCBI-ProteinID: AIT82181
Position
pLA3:546357..547355
AA seq 332 aa
MAKNRPLMTAADVDGFWAIIPTPAKEGADRWDATDTVDVDETARAIEDLIAKGVNGILTM
GTLGEASTLTWPEKQAFMTAAVETARGRVPIFVGTSTLNTRDTIEQTRWASDLGADGTML
GPPFWCQASMDMAVQYFKDVAQACPDMAIAIYANMQAFKFAFSIPFWARVSQIPQVITAK
LPPTPQMSAMKLVSGGRIRFMPIDNEYASVARSDPEFFSAFWSSSASCGPDVCIALRDRV
IEAKKTGDWSAVTRLSDAMELAVAPLFPAGGPPEFATYNIILEKHRMNVAGWIKAGPTRA
PYNHAPPHILEGAEKSGAAWAKLNKDVLAGNI
NT seq 999 nt   +upstreamnt  +downstreamnt
ttggcaaagaaccgacccttgatgaccgctgcggacgtggacggattttgggcaatcatt
cccaccccggccaaggaaggcgcagatcgctgggacgcgaccgacacggtcgatgtcgac
gagacagcccgggcgatcgaagacctgatcgcgaaaggcgtcaacggcatcctgacgatg
ggcacgctgggcgaggcatcgacgctgacctggccggaaaagcaggccttcatgaccgcc
gccgtggaaaccgcccgcgggcgcgtgccgattttcgtaggcacctcgacgctcaatacc
cgcgacaccatagagcagacccgctgggccagcgatctcggggcggacgggacgatgctt
ggcccgccgttctggtgccaggccagcatggacatggccgtgcagtacttcaaggacgtc
gcgcaagcctgccccgacatggccatcgccatctatgccaacatgcaggccttcaagttc
gctttctcgattccattctgggcacgggtgagccagatcccccaggtaatcaccgcaaag
ctgccgcccacgccgcagatgtcggcgatgaagcttgtcagcggcggacgcatccggttc
atgccgatcgacaatgaatatgcctcggtggcccgatccgatccggaattcttctccgca
ttctggagcagcagcgcttcttgcggcccggacgtctgcattgccctgcgcgaccgggtg
atcgaagccaagaagactggggactggagcgccgtcacccggctctccgatgcgatggaa
ttggcggtcgcccccttgttcccggctggagggcctcccgaatttgcaacctacaacatc
atcctggaaaagcaccggatgaatgtcgccggctggatcaaggccgggccgacccgcgcg
ccctacaaccatgctcccccgcatatccttgaaggcgccgaaaaatccggcgccgcatgg
gccaagctcaacaaggacgtgttggcgggcaatatctga

DBGET integrated database retrieval system