KEGG   Novosphingobium sp. PP1Y: PP1Y_AT1221Help
Entry
PP1Y_AT1221       CDS       T01515                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00260  Glycine, serine and threonine metabolism
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP1Y_AT1221
Enzymes [BR:npp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PP1Y_AT1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CCA91101
UniProt: F6IFM6
Position
137317..138312
Genome map
AA seq 331 aa AA seqDB search
MKFLSDNAASVHPAVWKAMMAADAADAPYDNDALSRELDARFSALFGRDCAALWVATGTA
ANCLALSAMVPPHGGAVCHREAHIEVDECGAPGFYMHGAKLMLAEGESAKLTPEAIAAVV
EPIRDDVHQVQPHAVSVTQVSEYGCAYRPGELSAIADYVRGRGLALHIDGARFANALAFL
GCSPAEAALGADALSFGFVKNGGMGAEAIVFFDPELARQARYRRKRAGHLQSKGRYLAAQ
ILAMLDNDVWLDNARAANAAAAEIAAAAEGRLLHPVEANEVFLATSAAEREALRAQGFEF
YDWGMDAARLVTAWDTRPEAAAALARAIAGL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctctccgacaatgctgccagcgttcatcccgcggtctggaaggcgatgatg
gctgcggacgcggccgatgcgccctatgacaacgatgcgctgagccgcgagctcgacgcg
cgcttctccgcgctgttcgggcgtgactgcgcggcgctgtgggtggccaccggcacggcg
gcgaactgccttgccctttcggcgatggtgcccccgcacggcggcgcggtctgccaccgc
gaagcccatatcgaggtcgacgagtgcggtgcgcccggcttctatatgcacggtgcgaag
ctcatgctggcagagggcgaaagcgcaaaactgacgccggaggcgattgccgcggtcgtc
gagccgatccgcgacgatgttcaccaggtccagccccatgcggtttcggtcacgcaagtg
agcgaatatggctgtgcctatcggcccggcgagctttcggcgattgccgactatgtcagg
ggacgcgggctggcgctgcatatcgacggcgcacgcttcgccaatgccctggcgtttctg
ggctgcagtccggcagaggcggcgctgggcgccgatgcgctcagcttcgggttcgtcaag
aacgggggcatgggcgccgaggcgatcgtcttcttcgatcccgagcttgcgcgccaggcg
cgctatcgccgcaagcgggcagggcacctgcagtccaagggccgttatcttgccgcgcag
atccttgccatgctcgacaacgatgtgtggctcgacaatgcgcgggccgcaaatgccgct
gcggccgagatcgcggcggcggccgaggggcgcctgctccacccggtcgaggccaacgaa
gtgtttcttgcgacaagcgccgccgagcgagaggcgctgcgcgcacagggcttcgagttc
tacgattggggcatggacgcggcgcggctggtaaccgcgtgggacacccggcccgaagcg
gctgccgcgctggcccgggcgattgccggactatga

DBGET integrated database retrieval system