KEGG   Novosphingobium sp. PP1Y: PP1Y_AT17787Help
Entry
PP1Y_AT17787      CDS       T01515                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:npp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PP1Y_AT17787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG
Motif
Other DBs
NCBI-ProteinID: CCA92659
UniProt: F6IMK7
Position
complement(1879350..1879781)
Genome map
AA seq 143 aa AA seqDB search
MPIAAPAPQPQAAPVDLGTLLAGAEPQVGQAKTQVCASCHDFTQGGPNRIGPNLWGVVGR
DIGSHAGFAYSDAMKSEPGNWSYEKLFDYLASPARDIPGNKMGFAGLRKPEDRAAVIRYL
ATLGGSAPPLPRPKEPAGETAAQ
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgccgcgcctgccccgcagccgcaggccgcacctgtggacctgggcaccctg
ctagccggtgccgagccgcaagtcggccaggccaagacacaggtctgcgccagttgccac
gatttcacccaaggcggcccgaacaggatcggtccgaacctgtggggcgtggttggccgc
gacatcggctctcatgccggtttcgcctattccgatgccatgaaatcggagcccggaaac
tggtcctacgaaaagctgttcgactacctcgcctcgcccgcacgggacattccgggaaac
aagatgggctttgccggtctgcgcaagcccgaggaccgggccgcggtcattcgctatctc
gccacgctgggcggcagtgcgcccccgcttccccggcccaaggagccggccggggaaacg
gcggcgcagtag

DBGET integrated database retrieval system