KEGG   Novosphingobium sp. PP1Y: PP1Y_AT31659Help
Entry
PP1Y_AT31659      CDS       T01515                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
npp  Novosphingobium sp. PP1Y
Brite
KEGG Orthology (KO) [BR:npp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PP1Y_AT31659
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     PP1Y_AT31659
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     PP1Y_AT31659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: CCA93920
UniProt: F6ILZ0
Position
complement(3326931..3327947)
Genome map
AA seq 338 aa AA seqDB search
MSTASDRSMSASPMRPVVGTMIGDPAGIGPEVTVKALADGSVHEVSIPVLVGSAAAVERA
LDMTGVKARVRRMRSFEAPSDEAGVIDVIDTGALPDGVLPLGEDTEVAGHATAQWLDELD
GLARDGSFAATIMGPISTGSLKMAGKLDKVISPTPGESYLVLLTGPLRVAHLTDHMSLRQ
VIDVITADLVAKAIGQVNDAMQSWGIARPRIAVAGLNPHAMGDEDRLAIAPGVERARASG
IAVEGPIAPDSVFRQCIEGRYDMVLAIFHDQGHIAVKTWGFSGNCVIMMGPPYLHMSVAH
GTAYDIVGTGKADAAMMRSAMRTCGQLASGQGFVGEAQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcatctgatcggtccatgtcagcttcaccaatgcgtcccgtcgtcgggacc
atgatcggcgatcctgccgggatcgggcccgaagtgacagttaaggcgctcgcggacgga
tcggtgcacgaagtgtcgataccggtgctggtcggctcggctgcggcggtggagcgtgct
ctcgacatgaccggggtcaaggcacgggtgcgccggatgcgctcgttcgaggcgcccagc
gacgaggccggggtgatcgacgtgatcgacaccggcgccttgccggacggcgttctgccg
ctgggtgaggataccgaagtggccggccatgccactgcgcaatggctggacgagttggac
ggtctggcccgggacgggtccttcgccgctacgatcatggggccgatcagcaccggttcg
ctcaagatggccggaaaactcgacaaggtcatcagcccgacgccaggcgaaagctatctg
gtgttgttgaccggccccttgcgggtcgcgcatctcaccgatcacatgtcgctgcgtcag
gtgatcgacgtcatcaccgccgatctcgtggccaaggcgatcgggcaggtcaacgatgcc
atgcaatcctggggaatcgcccgtcctcgtatcgccgtggccgggctcaacccccacgcc
atgggtgacgaggaccggctcgcgattgccccgggggtcgagcgggcgcgggcatcgggc
atcgcggtggaaggtccgattgcacccgattcggtgttccgccagtgcatcgaggggcgt
tacgacatggtcctggcgattttccacgatcagggacacattgcggtcaagacctggggt
ttttcgggcaactgcgtgatcatgatggggccgccctatctgcacatgtcggtcgcccat
ggtaccgcctatgacattgtcggcacgggcaaggcggacgcggcgatgatgcgcagcgcg
atgcgcacctgcggccagctcgcatcgggccagggatttgtgggagaagcgcaatga

DBGET integrated database retrieval system