KEGG   Novosphingobium sp. PP1Y: PP1Y_AT31984Help
Entry
PP1Y_AT31984      CDS       T01515                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00071  Fatty acid degradation
npp00072  Synthesis and degradation of ketone bodies
npp00280  Valine, leucine and isoleucine degradation
npp00310  Lysine degradation
npp00362  Benzoate degradation
npp00380  Tryptophan metabolism
npp00620  Pyruvate metabolism
npp00630  Glyoxylate and dicarboxylate metabolism
npp00640  Propanoate metabolism
npp00650  Butanoate metabolism
npp00900  Terpenoid backbone biosynthesis
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01200  Carbon metabolism
npp01212  Fatty acid metabolism
npp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP1Y_AT31984
   00630 Glyoxylate and dicarboxylate metabolism
    PP1Y_AT31984
   00640 Propanoate metabolism
    PP1Y_AT31984
   00650 Butanoate metabolism
    PP1Y_AT31984
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PP1Y_AT31984
   00072 Synthesis and degradation of ketone bodies
    PP1Y_AT31984
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PP1Y_AT31984
   00310 Lysine degradation
    PP1Y_AT31984
   00380 Tryptophan metabolism
    PP1Y_AT31984
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PP1Y_AT31984
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP1Y_AT31984
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PP1Y_AT31984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npp04147]
    PP1Y_AT31984
Enzymes [BR:npp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PP1Y_AT31984
Exosome [BR:npp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP1Y_AT31984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCA93951
UniProt: F6IHS0
Position
3362408..3363637
Genome map
AA seq 409 aa AA seqDB search
MTQLRTQSLRRAAIVAPLRTAVGKFGGSLSSMGAGDLGAVIIKALIERTGIDPARVDDVV
FAQGYGNGEAPAIGRWSWLAAGYPIEVPGYQLDRRCGSGLQAVIDAAMMVQTGASDVVLA
GGVESMSNVEHYTTQIRKGVKSGGLELHDRLTRGRVMSQPISRFGVITGMIETAENCAKD
YGITREACDAYAVRSHQRATAAWANGLFADELVPVPVPQRKGDPVLFAHDEGYRADATME
SLGALRPLEGGVVTAGNASQQNDAGAACLVVAEDKLEELGLEPIAWFHSWAAAGCEPSRM
GIGPVPAVERLFRRSGLGWNDLGVIELNEAFAPQVLAVLKGWGWSDDDSRHEILNVNGSG
ISLGHPIGATGGRILANLTREMQRRGSRYGLETMCIGGGQGLAAIFEKA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacccagctccgcacccaaagtctgcgaagggccgccatcgtcgcgccccttcgcacc
gccgtcggcaagttcggcggatcgctgtcctcgatgggcgcaggcgatctcggtgccgtc
atcatcaaggcgctgatcgagcgaaccgggatcgatcccgcacgggtcgatgatgtcgtt
tttgcccaaggctatggcaatggcgaggccccggcgatcgggcgctggtcgtggctggcg
gcgggctatccgatcgaggttcccggctaccagcttgaccggcgctgcggctcagggctc
caggcggtgatcgacgcggcgatgatggtccagaccggcgccagcgacgtggtgctggcg
ggcggtgtcgagtccatgtccaacgtcgaacattacacgacccagatccgcaagggcgtg
aagtcgggcgggttggaactgcacgatcggctgacgcgcgggcgggtgatgagccagccg
atttcgcgctttggcgtcatcaccggcatgatcgaaacggcagaaaattgcgccaaggat
tatggtatcacgcgcgaggcttgcgatgcctatgccgttcgcagccaccagcgcgccacg
gcagcctgggcgaacggcctgttcgccgatgaactggttcccgtgcccgtcccgcagcgc
aagggcgatcccgtgctgttcgctcacgacgagggctaccgtgccgatgccacgatggaa
tcgctcggtgcgctgcgtccgctcgaaggcggggtggtgacggcgggcaatgccagccag
cagaacgatgccggtgccgcctgcctcgtcgtcgccgaggacaagctggaggaactggga
ctcgaacctatcgcctggttccattcatgggccgcggcaggctgcgaaccgagccgcatg
ggcatcggcccggtgccggcggtcgagcggctcttccgccgctcgggccttggctggaat
gatctcggcgtgatcgaactcaacgaggccttcgccccgcaagtgctcgccgtgctcaaa
ggctggggctggtcggacgacgacagccggcacgagattctcaacgtcaacggttcgggc
atctcgctcgggcacccgattggcgcgacgggcgggcgcatcctcgccaatctgacgcgc
gagatgcagcggcgcggaagccgctatggcctcgaaacgatgtgcatcggcggcggccag
ggcctcgccgcgattttcgagaaggcatga

DBGET integrated database retrieval system