KEGG   Novosphingobium sp. PP1Y: PP1Y_AT35871Help
Entry
PP1Y_AT35871      CDS       T01515                                 

Definition
(GenBank) fructose-1,6-bisphosphatase II
  KO
K11532  fructose-1,6-bisphosphatase II / sedoheptulose-1,7-bisphosphatase [EC:3.1.3.11 3.1.3.37]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00010  Glycolysis / Gluconeogenesis
npp00030  Pentose phosphate pathway
npp00051  Fructose and mannose metabolism
npp00680  Methane metabolism
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01200  Carbon metabolism
Module
npp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
npp_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT35871
   00030 Pentose phosphate pathway
    PP1Y_AT35871
   00051 Fructose and mannose metabolism
    PP1Y_AT35871
  09102 Energy metabolism
   00680 Methane metabolism
    PP1Y_AT35871
Enzymes [BR:npp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PP1Y_AT35871
    3.1.3.37  sedoheptulose-bisphosphatase
     PP1Y_AT35871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: CCA94307
UniProt: F6IJQ3
Position
complement(3767207..3768187)
Genome map
AA seq 326 aa AA seqDB search
MSDKKTPASKVLDRVLVLEMVRVTEAAAIAASELIGRGDEKAADHAAVEAMRKAFDELYI
DGTVVIGEGERDEAPMLFIGEKVGGAPDRGPKIDIALDPLEGTTITAKAGPNALAVLAAA
EEGGLLNAPDVYMEKLAVGPGYPEGVIDLDKTPTENIKSIAAAKGVDPHEIIVCVLDRPR
HADLIEELRAIGCGIQLIPDGDVAGVIAVTDETTTIDVYMGSGGAPEGVLAAAALRCVGG
QMQGRLLFRNDDERARARKWGIEDLNKIYTLGELAKGDCIFAATGVTSGSLLDGVKRLKG
GKMTTESVVMRASSGTVRWIKGEHRH
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaagaaaactcctgcaagtaaagttctcgatcgcgttctcgttctcgaaatg
gtgcgcgttactgaggcggcagccattgccgcttccgaactcattggtcgcggtgatgag
aaagccgccgatcatgccgccgttgaggccatgcgcaaggcttttgacgaactttatatc
gacgggactgtcgtgatcggcgagggagagcgtgacgaggctcccatgctattcatcggc
gagaaggtcggcggcgctccagatcgtgggccgaagatcgacatcgccctcgatccgctt
gagggcaccacgatcacggccaaggccggaccgaatgctctggccgtcctggctgccgcc
gaagaaggcggcctgctcaacgcgccggatgtctacatggaaaagctggccgtggggccg
ggctatcccgagggcgtgatcgacctcgacaagacgccgaccgagaacatcaagtcgatc
gctgcggcaaagggcgtcgatccgcacgagatcatcgtgtgcgtgctcgaccgtcctcgc
catgcagacctgatcgaggagctgcgcgccatcggctgcggcatccagctcattcccgat
ggcgatgttgccggcgtgatcgcggttaccgacgagacgaccaccatcgacgtttacatg
ggctcgggcggcgcgcccgagggcgtcctcgccgccgctgcgcttcgctgcgtgggcggg
cagatgcagggccgcctgctgttccgcaacgacgatgagcgggcgcgtgcgcgcaagtgg
ggcatcgaggatctgaacaagatctacacgctcggcgaactggccaagggggattgcatc
ttcgcggcgaccggtgtgaccagcggctcgctgctcgacggtgtgaagcgcctcaagggc
ggcaagatgaccactgaaagcgtcgtcatgcgcgcaagttcggggacggttcgctggatc
aagggcgaacaccgccactga

DBGET integrated database retrieval system