KEGG   Novosphingobium sp. PP1Y: PP1Y_AT433Help
Entry
PP1Y_AT433        CDS       T01515                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00020  Citrate cycle (TCA cycle)
npp00640  Propanoate metabolism
npp00660  C5-Branched dibasic acid metabolism
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01200  Carbon metabolism
Module
npp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PP1Y_AT433
   00640 Propanoate metabolism
    PP1Y_AT433
   00660 C5-Branched dibasic acid metabolism
    PP1Y_AT433
Enzymes [BR:npp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PP1Y_AT433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: CCA91021
UniProt: F6IFE6
Position
44019..45218
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKELLAKYGVGIPAGIAALTVEEAVAAAKQLPGPLYVVKAQIHAGGRGKGKFK
ELGPDAKGGVRLAKSIEEVEAFAKEMLGNTLVTVQTGEAGKQVNRLYVTDGVDIAKEYYF
SMLVDRASGRVAMIASTEGGMDIEEVAHSTPEKITTVTIDPAEGFQPHHGRAVAYALKLD
GDLNKQAQKIAKQIYEAFMALDCDMLEINPLVETKDGQLLVLDTKMSFDSNALYRHPDVF
ALRDETEEDPAEIEASKYDLAYIKLDGDIGCMVNGAGLAMATMDIIKLNGSFPANFLDVG
GGATTEKVTAAFKIILKDPNVKGILVNIFGGIMKCDVIAEGIVAAAKEVNLGVPLVVRLE
GTNVQQGKDILANSGLPIVPANDLGDAAKKIVAEVKSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgaatatcaggcgaaggaactgcttgcgaagtatggcgtgggcattccc
gccggcatcgccgctctcacggtcgaagaagcggttgccgccgccaagcagctgcctggt
ccgctttatgtcgtgaaggcccagatccacgccggtgggcgcggcaagggcaagttcaag
gaactcggccccgacgcgaagggcggcgttcgccttgccaagtcgatcgaggaagtcgaa
gccttcgccaaggaaatgctcggcaacaccctcgtcaccgtgcagaccggtgaagctggc
aagcaggtcaaccgtctctacgtgaccgacggcgtcgacatcgccaaggaatactacttc
tcgatgctcgtcgaccgtgcctcgggccgcgtcgcgatgatcgcctcgaccgaaggcggc
atggacatcgaggaagtcgcgcactcgactcccgaaaagatcaccaccgtcacgatcgac
cccgccgaaggcttccagccgcaccacggccgcgcggtagcctatgcgctcaagctggac
ggtgacctcaacaagcaggcccagaagatcgccaagcagatctacgaggccttcatggcg
ctcgattgcgacatgctcgagatcaatccgctggtcgaaaccaaggacggccagctgctc
gtcctcgacaccaagatgagcttcgactcgaacgccctttaccgtcaccccgacgtcttc
gccctgcgcgacgagaccgaagaagacccggccgagatcgaagcgagcaagtacgacctc
gcctacatcaagctcgacggcgacatcggctgcatggtcaacggcgcgggccttgccatg
gcgacgatggacatcatcaagctcaacggctcgttcccggccaacttcctcgacgtgggc
ggcggcgccaccaccgagaaggtgactgcggcattcaagatcattctcaaggaccccaac
gtgaagggcatcctcgtgaacatcttcggcggcatcatgaagtgcgacgtcatcgcggaa
ggcatcgtcgctgcggccaaggaagtgaacctgggcgtgccgctcgtggttcgcctcgaa
ggcaccaacgtccagcagggcaaggacatcctggccaactcgggcctgccgatcgtcccc
gccaacgacctgggcgatgcagccaagaagatcgtcgcggaagtgaagagtgccgcctga

DBGET integrated database retrieval system