KEGG   Novosphingobium sp. PP1Y: PP1Y_AT6927Help
Entry
PP1Y_AT6927       CDS       T01515                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00010  Glycolysis / Gluconeogenesis
npp00052  Galactose metabolism
npp00500  Starch and sucrose metabolism
npp00520  Amino sugar and nucleotide sugar metabolism
npp00521  Streptomycin biosynthesis
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01200  Carbon metabolism
Module
npp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
npp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT6927
   00052 Galactose metabolism
    PP1Y_AT6927
   00500 Starch and sucrose metabolism
    PP1Y_AT6927
   00520 Amino sugar and nucleotide sugar metabolism
    PP1Y_AT6927
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PP1Y_AT6927
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PP1Y_AT6927
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PP1Y_AT6927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK PAR1
Motif
Other DBs
NCBI-ProteinID: CCA91636
UniProt: F6IJ10
Position
complement(739545..740519)
Genome map
AA seq 324 aa AA seqDB search
MELVTVDIGGTHARFAIASVDAGGAITLGDPATLHTKDHASFQLAWQAFREMNGGTLPDA
VAMSVAGPVGGEVIHFTNNPWIIRPALIEEKLGATRHTIVNDFAAVAHAVACAAEDDFLD
LAGPENTPLPASGTVSVLGPGTGLGVAHLWRDGKGTYHVQATEGGHIDFAPLDQIEDAVL
ARLRKRHNRVSVERVVSGPAIVDIYQTLAALEGRAIHELSDVEIWTAGTSGEDSLAAAAV
DRFCLSLGAAAGDYALAQGASGVVIAGGLGYRIRETILKSGFSDRFCAKGRFAGMMAKLP
VKLITHPQPGLFGAAAAFVREHTA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgtcactgtcgatatcggcggcacccacgcccgcttcgccattgccagcgtg
gacgcaggcggcgcgattacgctgggtgatccggcgactctgcacaccaaggatcacgcc
agcttccagcttgcctggcaggcctttcgcgaaatgaacggcggcaccctgcccgatgcc
gtggcgatgtcggtggccggtccggttggcggcgaagtgatccacttcaccaacaacccg
tggatcatccgccctgccctcatcgaggaaaagctgggcgcgacgcggcacaccatcgtc
aatgacttcgctgccgtggcccatgcggtggcctgcgccgccgaggacgatttcctcgac
ctggcaggccccgaaaacacgccgctgcccgcgtcgggcacggtgagcgtactcggcccg
ggcacgggccttggcgtcgcccatctctggcgcgacggaaagggcacctatcacgtccag
gcgaccgaaggcggccacatcgactttgccccgctcgaccagatcgaggacgccgtcctc
gcccggttgcgcaagcgccacaaccgcgtctcggtggaacgtgtcgtctccggccccgcc
atcgtcgacatctaccagacgctcgccgccctcgaagggcgcgccatccatgaactgagc
gatgtcgagatctggaccgccggtacgtccggcgaggacagcctcgccgccgccgccgtg
gaccgcttctgcctctcgctgggcgccgcggcgggcgactatgcccttgcccagggtgcc
agcggcgtcgtgatcgccggcgggctgggctaccggatccgcgaaaccattctcaagtca
ggcttttccgaccgtttctgcgccaagggccgcttcgccggcatgatggcaaaactgccg
gtcaagctgatcacccatccgcagcccggcctgttcggcgcggctgccgccttcgtcagg
gagcatactgcatga

DBGET integrated database retrieval system