KEGG   Nanorana parkeri: 108783671Help
Entry
108783671         CDS       T04897                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108783671
   04020 Calcium signaling pathway
    108783671
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:npr04040]
    108783671
Ion channels [BR:npr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108783671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans
Motif
Other DBs
NCBI-GeneID: 108783671
NCBI-ProteinID: XP_018407789
Position
Unknown
AA seq 560 aa AA seqDB search
MVILLNCVTLGMFQPCEDVDCSSDRCQILQVFDDFIFIFFAMEMVVKMVALGIFGKKCYL
GDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTL
PMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLDENFTIQGDITLPPYYQPEEDDEMP
FICSLSGDNGIMGCHEIPPLRDRGHECCLDKEDYYYYNSIRQEFNVSGMCVNWNQYYNVC
RTSNTNPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGS
FFMINLCLVVIATQFSETKQREHQLMQEQRALYLSSSTVASYAEPGDCYEEIFQYVCHIL
RKAKRRTVGLYNSLQSRRQSRIELSNAKLGINGKEQHQLWVCQKHNQLEHTPHAIVQPIA
MTLTSDLSNCPQCTKAKWDDGRKLSAPDSNKSSLEGTHGQNSEKGSGGSTSVLDKEGEED
SEEGFCERLCVEIRVKLRGIVDSKYFNRGIMIAILVNTISMGIEHHEQTDVITNKTCCPG
YFVFMTEEEIKKNSMPTPSL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtaatccttctgaactgtgttactctgggaatgtttcaaccgtgtgaagatgtggac
tgctcatcagaccggtgccaaattcttcaagtatttgatgacttcatctttatattcttt
gcaatggagatggtggtgaagatggtggccttggggatttttgggaagaaatgttacctt
ggagatacatggaacagactggatttttttatcgtaatggctgggatggtggagtactcc
ctggatctacagaatataaacctttctgcaatccgaactgtgcgtgtgctcagaccactg
aaggccatcaacagagtacctagtatgaggattttggtgaatttgctcctggacacactg
cccatgttgggaaacgtacttcttctgtgtttttttgtcttcttcatatttggaatcatt
ggggtgcaactttgggcaggtcttctacgtaaccgttgtttcctagatgaaaactttact
atacaaggcgatataacattgccaccttattaccaacccgaagaagatgacgagatgcca
tttatttgttctttatctggtgataatggaatcatgggatgccatgagatcccacctctc
agggatcggggtcatgaatgctgtttggataaagaagactattattattataactccatc
cgtcaagagttcaatgtcagtggcatgtgtgtcaactggaatcagtactataatgtctgt
cgtaccagcaacactaacccacataagggagccatcaattttgacaacattggctatgct
tggatagtaattttccaggtaattacgttggaaggctgggtggaaataatgtattatgtc
atggatgctcactccttctacaatttcatttattttatcctcctcataatagtcggatcg
ttcttcatgatcaatttgtgcctggttgttattgccactcagttctccgagaccaagcaa
agggaacaccagctgatgcaggagcagagggctttgtatttatcttctagtacagtagct
agttatgctgagcctggagactgttatgaagaaatttttcaatatgtctgccacatcctt
cgaaaggccaagcgtcgcacagtcgggctttacaacagccttcagagccggcggcagagt
cgtattgagctcagcaatgctaagttggggatcaatggcaaagaacaacatcagctttgg
gtatgtcagaagcacaaccagttggaacatactcctcatgcaattgtacagcctatagcg
atgacacttacctctgatctttcaaactgtcctcaatgtaccaaagctaaatgggatgat
ggccggaaactgtctgctccagacagcaacaagtccagtcttgaagggacacatggacag
aacagtgaaaaagggagtggtggaagtacatcagtgcttgacaaagaaggagaagaagat
agcgaagaaggcttttgtgaaaggctttgtgtagaaatccgcgtaaaactcaggggcata
gtggatagcaaatacttcaaccgaggaattatgatagctattcttgtaaatacaatcagc
atgggcattgagcaccatgaacagacagatgttattacaaataaaacatgctgcccagga
tatttcgttttcatgactgaagaggagattaaaaaaaactcaatgccaacacccagcctg
tag

DBGET integrated database retrieval system