KEGG   Nanorana parkeri: 108783815Help
Entry
108783815         CDS       T04897                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
npr  Nanorana parkeri
Pathway
npr00480  Glutathione metabolism
npr00590  Arachidonic acid metabolism
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108783815 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108783815 (GPX7)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108783815 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 108783815
NCBI-ProteinID: XP_018407974
Position
Unknown
AA seq 185 aa AA seqDB search
MYQAVLLLFFCFLAPSLQKDRDFYTFKLVNIRGKLVSLEKYRGSVSLAVNVASQCGYTDG
HYKALQKLQRDLGPYHFNVLGFPCNQFGHQEPDTDREIELFIRKQYSVSFPMFSKVAVTG
IGANAAFKYLTEASSKEPDWNFWKYLIGPDGKVVDAWGPTVSVEEIKPHITELVRKLILK
KKEEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaagctgtgcttctcctcttcttctgcttcctggccccgtccctgcagaaggac
cgggatttttacacctttaagttggtcaatatcaggggcaagctggtgtctttggagaag
taccggggatcggtgtcactggcggtgaatgtggccagtcagtgtgggtacacggacggc
cactacaaggcgctgcagaagctccagcgagacctgggaccttaccactttaatgttttg
ggattcccatgtaatcaatttggacatcaggagccagacactgatcgtgagattgaattg
tttatcaggaagcagtacagtgtgtccttccccatgttcagcaaggtagctgtcacgggt
attggagccaatgctgcgttcaaatatctgactgaggcctccagcaaagaaccggactgg
aacttctggaagtatctgattggtccagatggtaaggtggtagatgcttggggtccaaca
gtttccgtggaggaaattaaaccacatatcacagaacttgtgaggaaactgatcctgaaa
aagaaagaagagttatga

DBGET integrated database retrieval system