KEGG   Nanorana parkeri: 108784695
Entry
108784695         CDS       T04897                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
npr  Nanorana parkeri
Pathway
npr00230  Purine metabolism
npr00240  Pyrimidine metabolism
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108784695 (DCK)
   00240 Pyrimidine metabolism
    108784695 (DCK)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108784695 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 108784695
NCBI-ProteinID: XP_018409071
Position
Unknown
AA seq 271 aa
MATPPKRICTDLPPSPSSSTSSLGKKSKIKRISIEGNIAAGKSTFVCLLNKCNEDWEVVP
EPIARWCNVQSSQDEFQELTMSQKSGGNLLQMMYEKPERWSFTFQSYACLSRIRAQLKAF
NGKLREAENPVLFFERSVYSDRYIFASNLYEAECLNETEWTVYQDWHDWMNSQFCADLEL
DGIIYLRAAPEKCLNRIHTRGRDEEQGIPMEYLEKLHYKHESWLHHRTMKTDFAYLQDVP
ILTLDVNEDFKHDKQKQECMIEKVKEFLSTL
NT seq 816 nt   +upstreamnt  +downstreamnt
atggctaccccaccgaagagaatctgcaccgacctccccccttcacccagctcatccact
tcatctctaggcaagaagagcaaaatcaagaggatctccatagagggcaacatcgctgct
ggtaaatctacttttgtctgccttctcaataagtgcaatgaggactgggaggttgtccct
gaacctatagcaagatggtgcaacgttcaaagctctcaagatgaattccaggagctaacg
atgtctcagaaaagtggtggaaatctactgcagatgatgtatgaaaagccggaacgctgg
tccttcacgtttcagtcctatgcttgtctcagccgcatacgtgcccaactaaaagccttt
aatggcaaattaagggaagcagaaaatcctgtgctgttttttgagcgttctgtctacagt
gacaggtacatctttgcttccaatctgtatgaggcagaatgtctgaatgaaacagaatgg
acggtgtatcaggactggcatgattggatgaattcacagttctgtgctgatcttgaatta
gatggcattatttatcttcgagctgcacctgagaaatgtctgaacaggattcatacccgt
ggaagggacgaagaacaaggaattccaatggaatacctagaaaaacttcattacaagcac
gagagctggcttcatcacaggaccatgaagacggattttgcatatctgcaagacgtaccc
atcttgacactcgatgtgaatgaagattttaaacatgataagcagaagcaggaatgcatg
attgaaaaggttaaagagtttttaagcactttataa

DBGET integrated database retrieval system