KEGG   Nanorana parkeri: 108785256
Entry
108785256         CDS       T04897                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
npr  Nanorana parkeri
Pathway
npr00100  Steroid biosynthesis
npr01100  Metabolic pathways
Module
npr_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108785256 (TM7SF2)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108785256 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 108785256
NCBI-ProteinID: XP_018409806
Position
Unknown
AA seq 420 aa
MADKIKTPRTKELEFGGSLGAVALIFLLPGTVLYLLLTCNTDDASVLRLPGPLPSLESLW
NPFALVVLLGWVSLQALLYMLPMGKIAEGITLRDNTRLKYKINAFQASLVTAIVTGVAVV
LRLPFSYVYDHFLQFAVASALLSLALSFFLYIKSLTAQESALAPGGNSGNALYDFFIGHE
LNPRIGSFDLKYFCELRPGLIGWCLINLCFLMKEIELRGSPSLSMILVCGFQALYVMDAL
WHEEAILTTMDIAHDGFGFMLAFGDLCWVPFTYSLQAYFLVSHAQELSTLAAVVIILINA
VGYIIFRGSNSQKNAFRRNPSDPSVAGLETIPTATGKRLLVSGWWGLVRHPNYLGDLIMA
LAWSLPCGVSHILPYFYVIYFTGLLVHREARDEHQCLKKYGLAWQEYCRRVPYRIFPYIY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcggacaagattaaaactccaaggacgaaagaactagaatttggggggtccttgggt
gccgtagcacttatttttctgttgcctggaaccgtgctgtaccttctgttgacgtgtaac
actgatgatgccagtgtgttgcgtttgcctggccctctgccttcattggaatcgttgtgg
aatccatttgctttggtggttttactgggctgggtgtctctacaagccctactgtacatg
ctgcctatgggaaagatagctgagggaattactttgagggacaacactcgcctaaaatac
aaaataaatgcgtttcaagcctccttggtgactgccattgtgacaggagtggcggtggtg
ctccggctgcccttctcatatgtgtatgatcacttccttcagtttgctgtggcctctgca
ctgttatctctggcgctaagctttttcctttacattaaatcactgacggcacaggaatct
gcactggcgccaggtggaaattcaggtaatgctttatatgactttttcattggacatgag
ttgaaccctcggattggctcctttgatctgaaatatttctgtgaacttcgtcctgggctc
attggatggtgtttgatcaacctgtgcttcctgatgaaggagattgagcttcgtggctct
ccttccctttctatgatcttggtgtgtggattccaagcactttatgtcatggatgctctt
tggcatgaggaagctatcctgactacaatggatattgcacatgatggatttggtttcatg
ttggcttttggtgatttgtgctgggttccattcacctattccctgcaggcatatttcctt
gtcagtcatgcacaggagctgagcactctagctgcggtggttataatcctcataaatgct
gtaggatacattattttcagaggctcaaattcacagaaaaatgctttccgaaggaatcct
tcagacccaagtgtagctggacttgaaaccatcccaacagcaactggaaaacggcttctg
gtatctggttggtggggtcttgttcgccatcccaattacttaggagatttaattatggct
ctagcctggtccttaccttgtggtgtctctcacatcctcccatacttctatgtaatttac
ttcaccggccttctggttcaccgtgaggccagggatgaacaccagtgcttgaagaaatat
ggactggcctggcaggagtattgcagacgggtcccctacaggatatttccatatatatac
taa

DBGET integrated database retrieval system