KEGG   Nanorana parkeri: 108786696
Entry
108786696         CDS       T04897                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:npr01009]
    108786696 (AKAP5)
Protein phosphatases and associated proteins [BR:npr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     108786696 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 108786696
NCBI-ProteinID: XP_018411549
Position
Unknown
AA seq 513 aa
MSGCKAESTDSSKEKLQYQTSNDKGQSDPVGKYFKGYSSMVFLKRGKHKRRQSRSNLVNL
SKDLQGSEKKTPNVAAKKGEVLGFEEVSSEFTCDSSLVESYHLNTTKEAKFSFRKLEDGT
FALETKNSNEPEKSESGLMKRSSTSRRKKGRYSHKPLKICFKKRSKALRKPSDSQEDYKK
ESTNLPCSIKQEDITCAAANQDEDSVQIQSTGKTWATFKRLVTRRKKLNSSLKRPSQPSA
QQFETNTSATCIQSVSQKKRFSNLRIPCMNFSRGKRSANVTLTSEDLLCTINSSENCATE
SVADSERSDEVLAAKYRLQRSLDVENRNSDGILDTCTEECPISENNLDQKGIKTCEFDPL
NKQHDQEIQSSQERKSDLQQDLKLKVNSKRQSQSPVEGQELMCEASVNDTHLQSTEVANG
PLLNEDISIHEDNISHITEVQTDDTNTDSENELSLVNDISDIVDPKSDIYEFLLIRTAAS
LVSKVIQQSIQQIVTEDALHNHVPCKASERFYI
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtcaggatgtaaagcagaatctactgactcatctaaagaaaagcttcagtatcaaaca
agcaatgacaaaggacaaagtgatccagttggcaagtacttcaaaggttactcctcaatg
gtgttcctcaagagaggtaagcacaaaagaagacaaagtcggagcaatctagttaacctt
tctaaggacttacaaggaagtgagaagaaaacccccaatgtcgcagctaagaaaggtgag
gttctgggttttgaagaggtctccagtgagtttacttgtgactcttcccttgtggagtcc
taccatcttaatacaaccaaggaggcgaagttcagtttcagaaaactagaagatggcact
tttgcgttagaaaccaaaaactctaatgagccggaaaagtctgaatctggactaatgaag
agatcttcaacatcacggcgtaagaagggccgttactctcacaagccattgaaaatttgt
ttcaaaaaaagaagcaaagcccttaggaaaccttcagattcacaagaagactacaaaaag
gaaagtacaaatttgccttgttcaataaaacaagaggacattacctgtgctgcagccaac
caagacgaagattctgttcaaattcagtcaacaggcaagacctgggcaacatttaaaaga
ctagttacccgtagaaagaaattaaactcctccttgaaaagaccatcccaacccagtgct
caacaatttgaaaccaacacaagtgctacttgtattcaaagtgtttcacaaaaaaaaagg
ttctccaaccttaggattccatgcatgaacttttctagaggaaagaggtctgcaaatgta
accctaacgtctgaagaccttctctgtacaataaattcatcagaaaactgtgcaacagaa
tcagtagctgacagcgaaagaagtgatgaagttttggcagctaaatatagacttcaaaga
tctctagatgttgagaataggaacagtgatggcatccttgatacttgtactgaagaatgt
ccaatatctgaaaacaacttggaccaaaaagggattaaaacgtgtgagtttgatccccta
aataagcaacatgaccaggaaattcaatcttctcaagaaagaaaaagtgatttgcaacaa
gatctcaaattaaaagtgaattccaaaagacaatctcagtctcctgttgaaggacaagag
ctaatgtgtgaagcgtctgtaaatgatacacatttacaaagcactgaagtagcaaatggg
cctctgctaaatgaagacatatccatccacgaagataacatcagtcatataacagaggtc
caaacagatgatacaaatactgatagtgaaaatgaactgtctttggtcaatgacatttct
gatatagtggacccaaaatctgatatatatgaatttcttctaataagaacagctgcctct
cttgttagtaaggtcattcagcaatccattcaacagatagtcacagaagatgctttacat
aaccatgtcccatgtaaagcctcagagagattctatatttga

DBGET integrated database retrieval system