KEGG   Nanorana parkeri: 108786864Help
Entry
108786864         CDS       T04897                                 

Gene name
MGAT2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
npr  Nanorana parkeri
Pathway
npr00510  N-Glycan biosynthesis
npr01100  Metabolic pathways
Module
npr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    108786864 (MGAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:npr01003]
    108786864 (MGAT2)
Enzymes [BR:npr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     108786864 (MGAT2)
Glycosyltransferases [BR:npr01003]
 Glycan extension
  N-Glycan
   108786864 (MGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2 FeoB_associated FMN_bind_2
Motif
Other DBs
NCBI-GeneID: 108786864
NCBI-ProteinID: XP_018411757
Position
Unknown
AA seq 434 aa AA seqDB search
MRCRIYKKKVILLALVVVACGLALWNSGRQKKNDFVQDSDVEKPNGKGHVSPGSRKISND
SAPEKIQKAEVDNVTMVYRSVVFQLNFDQTIKNLETITNRPQDDVVIVVQVHNRPDYLRY
LLESLRKAKGIENVLLIFSHDYWSAELNQIVASVDFCQVLQIFFPFSIQLYPNEFPGHDP
KDCPRDIEKKDAIKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWEKVKVLKEHKG
LVLFIEEDHYLSPDFYYVLKKMWSKKTEECPECDVLTIGSYARLQSFAEKADKVEVKTWK
STEHNMGMAITRETYLKLIECTDTFCSYDDYNWDWTLQHLTVTCLPKFWKVMVPEIPRIY
HIGSCGMHHKKSCKATTESAKMEAMFTGNQPYLFPENVAIAHRYSMGALSPLVKNGGWGD
IRDHELCKSYRRLQ
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgccgcatatataaaaagaaagtcatccttctggctttagtggtggtagcctgc
ggcctggcactgtggaacagtggcagacaaaaaaaaaatgactttgttcaagactcggac
gtggagaaaccaaacgggaagggtcatgtgtccccagggagtaggaaaatttctaatgac
tctgcccccgagaaaatacagaaagcggaggtggacaacgtgactatggtgtacagatct
gtcgtttttcagctgaattttgaccaaactattaagaacttggaaacaattaccaatcgg
ccacaggatgacgtggtcatcgtagtgcaagtgcacaatcgaccggactatttaagatat
ctcttggagtctttacgaaaagccaagggcatcgagaacgtgctgttgattttcagccac
gattactggtcggccgagttgaatcagattgtcgccagcgtggatttctgtcaagtgctc
cagatctttttcccatttagcatccagttataccccaatgaatttcccgggcacgaccca
aaagactgccccagagacatagaaaaaaaagatgccattaagctcggttgcatcaacgcg
gagtacccagactccttcgggcattaccgcgaggctaaattctcgcaaacgaagcaccac
tggtggtggaagctgcattttgtttgggagaaggtaaaggttttaaaagagcacaagggc
ctagtccttttcatcgaggaagaccactacttgtctcccgacttctattacgtgcttaaa
aagatgtggagcaaaaaaactgaagaatgcccagagtgcgacgtgttgaccatcgggagc
tatgcccgtctccagtcattcgccgaaaaagcggacaaagtggaggtgaaaacgtggaag
tctacggaacacaacatgggaatggccataaccagggagacatatctgaagctcatcgag
tgcacagacactttttgttcttacgacgactataactgggactggaccttgcagcacctg
accgtcacttgtcttcctaagttctggaaagtcatggttcccgaaattcccaggatatat
cacattgggagttgtgggatgcaccataagaaatcttgcaaagcaaccacagaaagtgcc
aaaatggaagccatgtttacaggcaaccaaccgtacctatttcctgagaacgtagccatc
gcccaccgatactcaatgggcgctctgtccccgctggtgaaaaacggggggtggggggac
attagagaccatgaattatgtaagagctatcgcaggctgcagtaa

DBGET integrated database retrieval system