KEGG   Nanorana parkeri: 108788379Help
Entry
108788379         CDS       T04897                                 

Gene name
HSD17B8
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
npr  Nanorana parkeri
Pathway
npr00061  Fatty acid biosynthesis
npr00140  Steroid hormone biosynthesis
npr01100  Metabolic pathways
npr01212  Fatty acid metabolism
Module
npr_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    108788379 (HSD17B8)
   00140 Steroid hormone biosynthesis
    108788379 (HSD17B8)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     108788379 (HSD17B8)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     108788379 (HSD17B8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2 3Beta_HSD GDP_Man_Dehyd TrkA_N
Motif
Other DBs
NCBI-GeneID: 108788379
NCBI-ProteinID: XP_018413634
Position
Unknown
AA seq 255 aa AA seqDB search
MAASSRLKSTLALVTGGGSGIGRAVCQRLSREGASVAVVDVNVNSANDTLRMLSRDLPGQ
EHAAFAADVSRADSVSALMEQIQSLFSSPPRVAVSSAGITRDEFLLRLSEESFDAVLSVN
LKGPFLITQAVARAIVASGQNGGSIVNIGSIVGKVGNLGQSNYAAAKAGVEGLTKTAAKE
LAKFDIRCNTVLPGFVSTPMTDKVPQKVLDKIAGLIPMGRLGQPEDIADVCAFLASNDSR
YITGASIEVTGGLYL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctccagcaggctgaagtccacactggctctggtgacaggtggcggcagtggc
atcggaagagcggtgtgccagagactttcccgtgaaggggcttcggtcgccgtcgtcgac
gtgaacgtcaactctgctaatgacacgctacggatgttatcgcgtgacctccccggacaa
gagcacgcggcgttcgcggccgacgtctcccgggccgacagcgtcagcgcgctaatggag
cagatccagtcgctcttctcctcgcctcctcgtgtcgccgtcagcagcgccggaatcaca
cgggacgagtttctgcttcgcttgtcggaggaatcctttgatgctgtgctcagcgtcaac
ctcaagggaccatttctcattacacaagccgtggcccgagctatcgtagcctcgggccag
aatggaggctccatcgtcaacatcggcagtattgtgggaaaggtgggcaatctcggtcag
tctaactacgctgcagccaaggccggagtagaaggtttgactaagacggccgccaaggaa
ctggctaagttcgatatccgctgtaacaccgtactgcctggattcgtctccacgccgatg
actgacaaagtgccgcagaaagtcctggacaagatcgccggtctgataccaatgggaaga
cttggacagcctgaagatatcgcagatgtctgtgcgttcctggcctctaatgacagcaga
tatatcacgggagcaagtattgaggtgacaggtggactgtatttgtga

DBGET integrated database retrieval system