KEGG   Nanorana parkeri: 108788450
Entry
108788450         CDS       T04897                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
npr  Nanorana parkeri
Pathway
npr00230  Purine metabolism
npr01100  Metabolic pathways
npr04020  Calcium signaling pathway
npr04114  Oocyte meiosis
npr04261  Adrenergic signaling in cardiomyocytes
npr04270  Vascular smooth muscle contraction
npr04371  Apelin signaling pathway
npr04540  Gap junction
npr04912  GnRH signaling pathway
npr04914  Progesterone-mediated oocyte maturation
npr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108788450 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108788450 (ADCY4)
   04020 Calcium signaling pathway
    108788450 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108788450 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108788450 (ADCY4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108788450 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    108788450 (ADCY4)
   04916 Melanogenesis
    108788450 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108788450 (ADCY4)
   04270 Vascular smooth muscle contraction
    108788450 (ADCY4)
Enzymes [BR:npr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108788450 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA DUF349
Other DBs
NCBI-GeneID: 108788450
NCBI-ProteinID: XP_018413709
Position
Unknown
AA seq 1077 aa
MPENSRAHLGPYSARCHREKEGVFFESYYRLRQQYPVILLLLLIVLAICCSLIATTFATG
RAFLDNTGFLVSVFCALGVFAILFILVCIETVLRKGIKLLAIVIWGCLVAMGYAFIFTSS
VVTPWDQVYWTLFVTISLYTMLPLCMKGAIVAGLTCSVSHIIVLSVYVSSSSQQNAGDFA
VQMIADAVILLCGNVVGGYHKRVTESALKDTYREAINFIHSRRKLDSQERQQEQLLLSIL
PQYIATEMKEEIIERLKEKRPQQESTNNFHNLYIKRHKDVSILYADIVGFTLLSSECSPK
ELVLMLNELFGKFDQIAKENNCMRIKILGDCYYCVSGLPECLPDHAKNCVQMGLDMCQAI
RKLRKATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITE
ATLSHLGGDYEVEDVTHRQRDPYLKENNIKTYLVIDPRASDDSEEDDIFPNKSVEVTKTR
ASVRMTRYLESWGAAKPFAHLNHRDSLIPEALSSSRIMDLPMSSIHTTRNTDKSRSPKET
NEPSNENIFNVLEELNSLRQWKKSDDFNRVTLYFNQPAIEKEYRLSDLPSFKYYTACCFF
IFTCNFAVQMLVSPKNIALGISYGISYFIFLLYLFTCFAGHLVKCILKGPQILHWVPSLS
SAVSSKPWFRVPFGILIIFTVMFMAVFNMFFLPDEACPGMSFNTSVTPFTESLTVYSLPY
YMYCCILGLLACSAFLIMNFEVKLILLSIALVIYNIIFLHTHSWLSDCYMDWLLKNQNIS
RPGVLKEPQIMGSVALFIFFFTLLALARQNEFYCRLDFLWKRKFKMEHERIETMENLNRV
LLENVLPADVAQQFIGQNLRNEDLYYQSYDCVCVIFASIPDFKEFYTECDENHEGLECLR
LLNEIIADFDELLSKPKFSSVEKIKTIGSAYMAATGLNATSGQENLQDGDRNFNHIGIMV
EFATAMIGKLDVINKHSFNNFKLRVGINHGPVVAGVIGAQKPQYDIWGNTVNVASRMDST
GILGKIQVTEETSKVLQKLGYTCERRGVIKVKGKGQLCTYFVINDMARSNSQGNVLN
NT seq 3234 nt   +upstreamnt  +downstreamnt
atgccagagaacagcagggctcacctgggcccttactccgcacgatgtcacagggaaaag
gaaggcgtcttttttgagtcctactaccgattgcgtcagcagtatccagtaatccttctt
ctgctgcttattgtcctagcaatatgctgctcgcttatagccaccacctttgccaccggg
cgggcgttcttggacaatactggcttcctggtgagcgttttttgtgccttgggagtgttc
gctatactcttcatactggtgtgcatagaaactgtgctgcggaagggtataaagttatta
gcaatcgtcatctggggatgcttggtagccatgggctatgcgttcattttcacaagcagt
gttgttactccatgggaccaggtttattggacgttatttgtgacgatcagcctgtacacc
atgctcccattatgtatgaaaggggcgatcgttgctgggcttacctgctcagtgtcgcat
atcatagtgctcagtgtctacgtgtcatcatcaagtcagcagaatgcaggagattttgcc
gtacagatgatcgctgacgcagtcatcttgctgtgtggaaatgtggtgggaggttatcac
aagcgtgtcacggagagtgcattaaaggacacttatcgcgaagccatcaacttcattcat
tccagacgtaagctggactctcaggagaggcagcaggaacagttgttactttccatctta
ccacagtatatagccaccgagatgaaagaagagatcatagagaggctgaaagaaaagagg
ccgcagcaggagagtaccaacaactttcataatctgtatatcaaacggcacaaagatgta
agtattctgtatgcagacatcgttggcttcacacttctctcaagcgagtgctccccaaag
gagttggtcctcatgttaaatgagctttttggaaagtttgaccagatagcaaaggaaaac
aactgcatgcgcatcaagatcctgggtgattgctattattgtgtgtcagggctgccagaa
tgcttacccgaccatgccaaaaactgtgtgcagatgggtttagacatgtgccaggcaatc
cggaagctgcgtaaggctacaggtgtggatattaacatgcgcgttggagtacattcagga
aacgtattgtgtggagtcattgggctccagaaatggcaatatgatgtctggtcacatgat
gtaacattggccaatcatatggaagcaggtggagttccagggagagttcatattacagaa
gccactctgtcccatcttggaggtgattatgaggtagaggatgtaactcatcggcagaga
gacccctaccttaaagaaaataacataaaaacatatctcgttattgaccccagggctagt
gatgacagtgaggaagatgacatatttccaaacaagtctgttgaggtcaccaagacaagg
gcatctgttcgaatgacacgctatctggaatcttggggggctgctaaaccatttgcacac
cttaaccacagagacagcctcataccggaagccctaagttcctcccgcattatggatctc
ccaatgtcatctatacatacaacccggaatactgacaaatctcgttctccaaaggagaca
aatgagccatccaatgagaacatctttaatgttctggaggagctgaactccctaaggcag
tggaagaaatctgatgattttaaccgggtcaccctctacttcaatcagccagcaatagag
aaagagtaccggctctctgacctgccatcgttcaaatattacacagcctgttgcttcttc
atctttacctgcaactttgctgtccagatgttggtgtctcccaagaacatagctcttggc
atctcgtatggcatatcttatttcatattcctactctacttatttacttgctttgctgga
catctggtgaaatgtatcctcaaaggacctcagatcctgcactgggttccttctctctcc
tctgcagtctccagcaagccctggttcagagtgccctttggaatcctgatcattttcact
gtcatgtttatggcagtattcaacatgttttttctacctgatgaagcatgtccgggaatg
tcatttaatacgtctgtaactccattcactgaatctctaacagtatatagcctgccgtat
tacatgtactgttgtattctggggcttctggcttgttctgccttcttgattatgaacttt
gaagtcaagctgatccttctcagcattgccctggtgatctacaatatcatcttcttgcac
actcacagctggttgtcggactgttacatggattggcttcttaagaaccagaacatctct
aggcctggagtcctaaaagagccacaaattatgggcagtgttgcattatttatcttcttt
tttactcttcttgccctggccagacagaatgaattttattgtcgccttgactttctgtgg
aaaaggaagtttaagatggagcatgaacgtattgagactatggagaatctgaacagggtc
ttactagaaaatgtactccctgctgatgtagcccagcagttcattggacagaacctaagg
aatgaggacctgtattaccagtcctatgactgtgtctgcgtcatatttgcttccatacct
gacttcaaggaattttacacggagtgtgatgaaaaccatgagggcctagagtgtctaagg
ctacttaatgagattattgctgactttgatgagctactttctaagccaaagtttagcagt
gttgaaaaaataaagaccattggtagtgcatacatggcagcgacgggattaaatgccaca
tctggacaagaaaaccttcaggatggtgacaggaattttaaccacatcggaatcatggtg
gaatttgctactgcaatgattggaaaacttgacgtcatcaacaagcactcttttaacaac
ttcaaacttcgcgtaggtattaatcatggacctgtagtagctggggtaataggagcacag
aagcctcagtatgacatctgggggaacactgtcaatgtggcaagtcgcatggacagtact
ggaatacttggcaaaatccaggtcacagaagaaaccagtaaagtacttcagaagctggga
tatacttgtgaacggcgaggggtcatcaaggttaagggtaaaggtcaactctgtacctat
tttgttatcaatgacatggccagatccaattcccagggaaacgttctaaattaa

DBGET integrated database retrieval system