KEGG   Nanorana parkeri: 108788787Help
Entry
108788787         CDS       T04897                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
npr  Nanorana parkeri
Pathway
npr00120  Primary bile acid biosynthesis
npr01100  Metabolic pathways
npr03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    108788787
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    108788787
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:npr00199]
    108788787
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     108788787
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     108788787
Cytochrome P450 [BR:npr00199]
 Cytochrome P450, animal type
  CYP8 family
   108788787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 108788787
NCBI-ProteinID: XP_018414146
Position
Unknown
AA seq 511 aa AA seqDB search
MALLLPILLAVLASILGGLYMLGMFRKRKPNEPPLDKGTIPWLGYALEFRNNSAAFLQRM
QKKHGEIFTVQIAGYYFTFVTDPLSFGTIVKECKTKLDFEQFATELVARVFGYHSGPSDH
KMLEKSSTKHLMGDGLVIMTQAMMDNLQNLMLHEVGPGNGERKWCQEGLFHYSYNIVFRA
GYLALFGNEPGKSKDGAEMAKKLDRDVSDELYNEFRKYDKLFPRLAYAVLTPKGKMEAER
LKRLFWNMLSIKRTLQKENISGWITDQFQYRAENGMTEAMQDRFMFLLLWASQGNTGPAC
FWLLLFLMKDPEAMKAVNEEVQKVLKETNQEVKPGGPLINLTRDMLLKTPILDSAVEESL
RITAAPVLVRAVKESLNLKMSSGKEYAIRKGDRVGLFPYTAVQMDPEVHPEPEKFKYNRF
LNEDGTKKTEFYKNGKRLKYFTMPWGAGTTICPGRFFAINELKQFVFLMLLYFEFELVNP
NEEIPPIDPNRWGFGTMQPTKDVQFRYRLRY
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggctctgttactgccaatcctcctggctgtattggcttctattctcggaggtctctac
atgttgggaatgttccggaagaggaaacccaatgagccaccactagacaaagggaccatc
ccgtggttaggatacgcccttgagttccgtaacaactcagccgccttcttgcagaggatg
cagaagaaacacggagaaattttcacagttcagatcgccggctattacttcacctttgtg
acagatccgctctcctttggtaccatcgtcaaggaatgcaagacaaagctggactttgag
cagtttgctacagagttggtggcccgggtgttcggctaccattctggacccagtgaccac
aagatgctggagaaatccagcacgaagcacctcatgggtgatggtcttgtaatcatgacc
caagctatgatggacaacctgcaaaacctgatgctccacgaagttggacccggaaacggt
gaaagaaaatggtgtcaagaagggcttttccactacagctacaacattgtcttccgagcc
ggctacctggctttattcggcaatgaaccaggtaaaagcaaggatggggcggaaatggcc
aagaagcttgatcgcgacgtctcagatgaactgtataatgagttcaggaagtacgacaag
ttgttcccacgtctggcttacgccgtactgacgccaaaaggcaagatggaagctgaaagg
ctaaagaggctcttctggaacatgctttccataaagagaaccctacagaaagaaaatatc
agcggatggatcaccgaccagttccagtatagagctgaaaatgggatgacggaagctatg
caagacaggttcatgtttcttctcttgtgggcctctcagggtaatacaggacccgcgtgt
ttctggctccttcttttcctcatgaaagacccagaagccatgaaggccgtcaacgaggaa
gttcaaaaagttcttaaggaaaccaaccaagaagtcaaacctggcggaccactcatcaac
ctcaccagagatatgctgctgaagaccccgattctggacagcgcggtggaagagagcttg
cgtattacagccgctcctgtcctggtaagagccgtcaaagagagcctgaacctcaaaatg
tccagcgggaaagagtatgccatccgtaaaggtgaccgcgtgggtcttttcccgtacact
gcggtccaaatggatccagaggtccatccggagccggaaaagttcaagtacaaccgcttc
ctgaatgaggatggcaccaaaaagactgagttctacaagaacgggaaacgactgaagtat
ttcacaatgccgtggggagccgggaccaccatttgccccgggcgttttttcgcaatcaac
gaactcaaacagtttgtgtttcttatgctcttgtatttcgagtttgagcttgtgaatccc
aacgaagagattccacccatcgaccccaaccgttggggttttggaaccatgcaacccacc
aaagatgtccagttcaggtacaggttacgctactag

DBGET integrated database retrieval system