KEGG   Nanorana parkeri: 108789185Help
Entry
108789185         CDS       T04897                                 

Gene name
PRODH2
Definition
(RefSeq) probable proline dehydrogenase 2 isoform X1
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
npr  Nanorana parkeri
Pathway
npr00330  Arginine and proline metabolism
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    108789185 (PRODH2)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     108789185 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 108789185
NCBI-ProteinID: XP_018414634
Position
Unknown
AA seq 468 aa AA seqDB search
MWSLVRSLNLRSSLVAPPSSWGPSLSCTGRSCHRTSAHGADSALNFSDGRVFRLKSHWEV
VRGLLIFRMCSFPSLVKNSEKLMAVSRRLLGRRLFEWGMRGTVYGQFVAGESLPEIQASM
ERLRKLGIRPMLAVPIEEDLGEGKAGERWYEQNEAIMMNCVDLSSLGGDRPMMQLKITAL
MSADLCKVLSMCLSDPSRRKELSPHRIVSIMEGKDARFSFLSEQQNQHLQSSVRRLSRVG
KHAVQKQVRVLVDAEYTYMNPALGVVTMAMMAQCNRKEPWIWNTYQCYLKDSFRNLSQEL
DTAVALGLCFGVKLVRGAYMDKERKLAKVKGYPDPIQPDWEATNRSYNGCLDKLLDLIGR
EGERYNLIIASHNEESVLHAVRRMKELGIDKHSRAVCFGQLLGMCDHVSLTLGQAGYLVY
KSIPYGSVDSVLPYLVRRAQENQSVLQGIRKERDLLHEEWRRRLLGRS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtggagtctcgtccggtctttgaatctcaggtcttccctggtggcccccccttcatca
tggggtccgtcgttgtcctgcacgggacggtcctgtcacagaacgtcagctcacggtgct
gactcggcgctgaacttttccgatggaagggtcttcaggctgaagagccactgggaggtg
gtgagggggcttctcatattccggatgtgctccttccccagcctggtgaagaattccgag
aagctcatggcagtctcccgcaggctcctgggccgccgcctcttcgaatggggtatgagg
ggcaccgtgtacgggcagtttgttgccggggagtcccttccggagattcaggcgtccatg
gagaggctgaggaaattgggcattcggcccatgctggctgtgccaattgaggaggacctg
ggagagggcaaagctggggagcgatggtacgagcagaacgaagccatcatgatgaactgc
gtggatctgtcatccttggggggcgatcgtcccatgatgcagctgaagatcacggcgctc
atgagtgctgatctgtgcaaagttctgtccatgtgtttgtctgatccgtctcggaggaag
gagctcagtccacacaggatagtgtccatcatggaggggaaggacgccaggttctccttt
ctgtcggagcagcagaaccagcacctacagagttctgtccgcaggctgagccgggttggg
aagcatgccgtacagaaacaagtgcgggtcttggtggacgcggagtacacgtacatgaac
cccgccctcggtgtggtcaccatggccatgatggcacagtgcaaccgcaaggagccgtgg
atctggaacacctaccagtgctatctgaaggactcgttccgaaacttgtcccaggagctg
gacacggcagtggctttgggtctgtgtttcggggtgaagttggtgcgtggggcgtacatg
gacaaggagaggaagttggccaaagtgaagggatacccggatcccatccagccagactgg
gaagccactaacaggagttacaatggctgcctggataagctgctggatctgattggacga
gagggggagcgctataacctcatcatcgccagtcacaacgaggagtccgttcttcacgca
gtacgaaggatgaaggagctcgggattgataagcacagcagagcggtgtgtttcggacag
ttgctgggcatgtgtgaccacgtctcgctcacgctgggtcaggcgggctacttagtgtat
aagtccattccgtacggatcagtggattctgtcctgccctacttggtccggagggcccag
gagaaccagagcgtcctgcaagggatccggaaggagagagacctcctacatgaagagtgg
agaagacgtctgctgggccggagctag

DBGET integrated database retrieval system