KEGG   Nanorana parkeri: 108789917Help
Entry
108789917         CDS       T04897                                 

Definition
(RefSeq) cytosolic phospholipase A2 delta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
npr  Nanorana parkeri
Pathway
npr00564  Glycerophospholipid metabolism
npr00565  Ether lipid metabolism
npr00590  Arachidonic acid metabolism
npr00591  Linoleic acid metabolism
npr00592  alpha-Linolenic acid metabolism
npr01100  Metabolic pathways
npr04010  MAPK signaling pathway
npr04217  Necroptosis
npr04270  Vascular smooth muscle contraction
npr04370  VEGF signaling pathway
npr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108789917
   00565 Ether lipid metabolism
    108789917
   00590 Arachidonic acid metabolism
    108789917
   00591 Linoleic acid metabolism
    108789917
   00592 alpha-Linolenic acid metabolism
    108789917
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108789917
   04370 VEGF signaling pathway
    108789917
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108789917
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108789917
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108789917
Enzymes [BR:npr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108789917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2 Papo_T_antigen
Motif
Other DBs
NCBI-GeneID: 108789917
NCBI-ProteinID: XP_018415563
Position
Unknown
AA seq 860 aa AA seqDB search
MARRQSAVSYQEESVLSQLTVKVIKASNIPWADLMSNADCYVSLWLPTATNSELKTATVS
NCSSPVWNETFEYTISNKVKNVIHLNLHDEDVISGNDLLYIVAFDVGNVLVGETKLKTFC
LDPKGEQTLDVEFTVQRIARGREKIVTNGVLVSREMSCLEISVDKQRIPENLLGGYLSLS
VEDSCERKFRMELKSATGSDHTYTCKFYCIRKWDPQLIAQLEGTNDQCLQVVPVKDLTVG
QEEKIHLSTVPVYANCWCFRCFLPLRWIQPGGSSALSQTEAEGTSSCWSPVIFLKARRLF
WMLKARPLEVKLKAINCTEKPNIRLGFGICNDEISFRSKRKKLVADALKKVLKLDRDLQE
HEVPVIALSATGGGLRAMVSLLGTLLALKKLNLLDCVSYITGLSGSTWAMSKLYADANWS
HKDLTETIKDARRNATKSKMSAFSFDNLSFYKAELNKRAEMGYKTSFTDLWGLVIESTMY
DKVNENKLTDQRQAVCNGQNPLPLYVAMNVKPKVNSTLDYKEWCEFSPYEVGLLKYGAFI
RSEDFGSEFFMGKKTKDLPESRICYLQGLWSNVFSINLLDAWYAAISSESFWHRFTRDNV
LDVDDEEAIQRRKLTACLDTRLLQPAGEFSNTVRSVLTNRPLDGEHHNFLRGLQMHSKYV
TENGFCAFDCTELDTSPNHLTPCAEDLCLVDCAYYINASFPPLLREERSVDMIMSFDYGL
VDKFKTVEQTEKYCSVHKLFFPKIEISEEDKQNPKECYVFADCDYPDFPVIMHFPLVNDT
FKKYKQPGVERETDQEKEEGDVPLSGLASPYKVFRFTYTEEDFDKLIKLTEYNALNSEEM
ILQTLRTTIERKQKRRSCNV
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaagacaatctgcggtctcctaccaggaggaaagcgtgctcagccaattaact
gttaaagtcataaaagcatcaaacatcccatgggcagacttgatgagcaatgctgactgt
tatgtgagtttgtggctcccgactgccactaatagtgagttgaagacagccaccgtgtca
aactgcagttctcctgtctggaatgaaacatttgagtataccatcagcaataaagtcaag
aatgtgattcatttgaatcttcacgatgaggatgtgatctctgggaatgatctgttatat
attgtggcttttgatgtggggaatgtcctcgttggagaaactaagctgaagactttttgt
ctagaccctaaaggagaacagactttggatgtagaattcactgtgcagcgaatagcacgt
ggtcgtgagaaaattgtgacgaatggagtgcttgtgtccagagagatgtcctgtcttgaa
atatctgttgacaagcagaggatcccagagaacttactcggtggctatctttctttatca
gtggaggattcttgtgaaaggaagttcagaatggagctaaagtctgccacaggcagtgat
cacacatacacctgcaaattttattgcatcaggaagtgggaccctcagctcatagcccaa
ttagagggtacaaatgatcagtgtcttcaagtggttccagtgaaggaccttactgttggc
caggaagaaaagatccacctttctacagtaccagtttatgcaaattgctggtgcttccgc
tgcttccttcccctgcgctggattcagccaggaggatcttcagctttaagccaaactgag
gctgaggggacctcaagttgctggtcaccagtgatcttccttaaagctcgaagactcttc
tggatgcttaaggccagaccattggaagtgaaactcaaagctataaactgcacagaaaag
ccgaacatccgtctggggtttgggatctgtaatgatgaaattagtttccgctcaaaacgg
aaaaagcttgttgctgacgcattaaagaaagttttgaagcttgaccgagacctgcaagag
cacgaggttcctgtgatcgctctttcagcgacaggtggaggtttgagggcaatggtttca
cttcttggaaccctgttagcgctgaagaaattgaatctcttggactgtgtttcctacatc
actggtttatctggatccacgtgggcaatgagtaaattatatgcagatgccaactggtca
cacaaagatctaactgaaacaataaaagatgctcgcaggaatgcgaccaaaagcaagatg
tctgccttttcctttgataacctatctttctacaaagctgaactgaacaagagggcagaa
atgggttataagacatccttcacagatttatggggcctggtcattgaatccacgatgtat
gataaggtgaatgaaaataagctgacagatcagaggcaagctgtgtgtaatggacagaac
cctctccctttatatgtggccatgaatgtcaaaccgaaagtgaactccacgttggattat
aaagaatggtgtgaattctccccctatgaagtcggacttctgaaatatggagccttcata
cgttcagaagactttggcagtgaattcttcatggggaaaaaaacaaaagatcttccagag
tccaggatctgctatcttcaggggttgtggagcaatgtcttttcaattaatctgctggac
gcctggtatgcggctataagctctgaaagcttttggcacagattcaccagggacaatgtg
cttgacgtggatgatgaagaagccatacagaggagaaaactcacagcgtgcctggacacc
cgtcttctacaaccagctggggagttcagcaacacagtgcgaagtgttcttactaaccgc
ccccttgatggagagcatcataattttctacgaggattacagatgcattccaaatatgtc
acagagaacggcttctgtgcatttgattgcacagaattggatacttccccaaaccacctg
accccttgtgcagaagatctctgtctggtggactgcgcatattacatcaatgcaagcttc
cctccgctattacgagaagagcgcagtgtggacatgatcatgtcatttgactatggactc
gtagataagttcaaaacagtggagcaaactgaaaaatactgttctgttcacaagctcttt
ttccccaaaattgaaataagtgaagaagacaagcagaaccccaaggaatgctacgttttc
gcagactgcgactacccagactttcccgtcatcatgcactttccattagtaaatgacaca
ttcaagaagtacaaacagccaggagttgagagggaaaccgatcaggagaaggaggaagga
gacgttcccttgtctggcctggcttcaccttacaaagtgtttcgattcacatacactgaa
gaagattttgataaactgatcaaactgacagaatacaacgccctgaacagcgaggaaatg
attctgcagaccttgcgtaccaccatagaacgcaaacagaaacgtaggagctgcaacgtc
tga

DBGET integrated database retrieval system