KEGG   Nanorana parkeri: 108789982
Entry
108789982         CDS       T04897                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:npr04040]
    108789982 (ASIC1)
Ion channels [BR:npr04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   108789982 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 108789982
NCBI-ProteinID: XP_018415651
Position
Unknown
AA seq 525 aa
MDVKEPEELGSPQPVSLQAFASGSTLHGIAHIFSYERFSCRRMIWILCFLGSLSLLLFVC
TERIIYYFDYPHVTKLDEISTARMTFPAVTFCNLNEFRFSRVTKNDLYHAGELLSLLNNR
YELPDSHLADEKVMETLQDKANFRNFKPKPFNMKEFYDRAGHDIKDMLLNCKFRGEECGP
DDFVPVFTRYGKCYTFNSGQNGRTPLITSKGGTGNGIELMLDIQQDEYLPVWGETDETSF
EAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSSAMDSEFFD
TFSISACRIDCETRYLVENCNCRMVHMPGDAAYCTPELYKECADPALDFLVEKDNDYCLC
ETPCNMTRYGKELSMVKIPSKASARYLAKKYNKSEQYIADNILVLDIFFEALNYETIEQK
AAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVLRYKLCGGAKCGKDSKRNNNDKG
VTLSMDDVKRHAPCEGVRGHPAGMSYTANILPHHAVRGAFEDFTC
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggatgtgaaggaaccagaggagctgggtagtccccagccagtctcacttcaggccttt
gcaagtggctccactttgcatggcattgctcacatcttctcctacgagcgcttctcatgc
cggcggatgatctggatattgtgtttccttggctccttgtcgcttctcctatttgtgtgc
accgagaggatcatctattactttgattacccgcatgtcaccaaactggatgagatttca
actgccaggatgacctttccagctgtgaccttctgtaacctcaatgagttccgcttcagc
cgagtgacaaagaatgacctttaccatgcgggggagctactgagcctgctcaacaaccgc
tatgagctaccagattctcaccttgccgatgagaaagtaatggaaaccttacaagataaa
gctaacttccgcaactttaaaccaaagccattcaacatgaaggaattctatgaccgcgct
ggccatgacatcaaagacatgcttctaaactgcaagttccggggagaggaatgtgggcct
gatgactttgttccagtttttacgagatacggcaaatgctacacatttaactcgggccag
aatggacgtacccctttaattacttctaaaggtggcacaggaaatggaatagagctgatg
ctggatatacagcaagatgaatatttaccagtttggggagagactgatgagacatccttt
gaggctggaatcaaagtccagattcatagtcaggatgaacctcccttcatagaccagctt
gggtttggtgtggctccgggattccaaacatttgtgtcttgccaggaacagcgactgaca
tacctgcctccaccatggggagactgtaaatcaagtgctatggactcagaattttttgac
acgttcagcatttctgcatgtcggatagactgcgagacccgctacttggtggagaactgt
aactgtcgcatggtgcatatgccaggagatgccgcttattgtacaccagagttatataag
gagtgtgcagacccagcactagatttcctggtggaaaaggacaacgactactgtttgtgc
gagactccatgtaacatgacacggtatgggaaggagctgtccatggtgaaaatccccagt
aaagcctctgcacgttatttagccaagaagtacaacaaaagtgaacagtacatagcggat
aatattttggttctggatattttctttgaagctctaaactatgaaactattgaacagaag
gcagcatacgaggtggcgggacttcttggggacatcgggggacagatgggcctgtttatt
ggagcgagcatcctcactgttctcgagctcttcgactatgcctatgaggtgttaagatac
aaactgtgcgggggtgcaaaatgtgggaaagactcgaaacgcaacaacaacgataaaggg
gtgacattaagtatggatgatgtcaaacgtcacgctccgtgtgagggtgtgagagggcac
ccagcaggcatgagctacacagctaacattctcccccatcacgcagtacgtggtgcattt
gaagacttcacatgctga

DBGET integrated database retrieval system