KEGG   Nanorana parkeri: 108790048
Entry
108790048         CDS       T04897                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:npr01002]
    108790048 (ERAP1)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     108790048 (ERAP1)
Peptidases and inhibitors [BR:npr01002]
 Metallo peptidases
  Family M1
   108790048 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 108790048
NCBI-ProteinID: XP_018415726
Position
Unknown
AA seq 928 aa
MNSLFYTGLFCMTWTVYSVSSVAVSAGDRDSSNNKFPWNNLRLPSYVFPLHYDLLIHPNL
TTFTVSGLAKITVVVTQPTSSVILHSKHLKITKTSMESKVGSSLVQQDVLLLEHPASEQI
ALQPAEPLNPGKNYTLYIEYNGNLSESFHGFYKSSYKTPDGEVRVLASTQFEPTAARLAF
PCFDEPAFKATFSVKMRREARHSAVSNMPIVKTVELGGGILEDHFDVSVKMSTYLVAFIV
SDFKSISEVTNRGVKISVYTVPHKIEQATYALSAAVKLLDFYEEYFRIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRESSLLYDPKTSTASSKLWITMVIAHELAHQWFGNLVTMDWWND
LWLNEGFAKFMEYIAVNITYPELQVEDKFLDKCFTAMEVDSLNSSHAVSTPVENTEQIHE
MFDEVSYDKGACILNMLQDYIGAESFEAGIINYLRRFSYRNAKNKDLWDSMTNICPSEGT
ASGNKEESGFCRKQSQKSHWTEDGIIDVKSMMNTWTIQKGFPLVTVTVKGKQVHLQQEHY
QKGAKDSESAGLLWHIPLTYITSKTNKIQRFLLKNKRDVLFLDEEVEWIKFNVGMNGYYI
VHYEGDGWDALIKLLQKNHTAVTSNDRTSLINNAFQLVSIGLLPIDKALSLTKYLRKEDK
IMPVFQGMDELIPIYKLMEKRDMKEIEEEMKAYILNLLRGLIDIQSWTDDGTVSERMLRS
SLLLFACFRKYQPCVDKAKDYFTKWQESNGTMSLPRDVVTAVYAVGAQTPEGWDFLFEKY
QTSPTGEMHLIEYALTLTQDKDKLQWLMDESLKGDLVKTQELPHMVVMVSRNQIGHKLAW
QFLKDNWDQLTQKFELGSRTLGDMVVGITRLFSTREWLEEVTEFFDLLKENGSQLRCVQQ
AKETIEENIRWMDKNFDLVKSWLDNNRS
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgaatagtctattttacactggacttttctgtatgacatggaccgtttactcagtgtcc
tctgtggcagtgagtgctggggacagggacagttctaataacaagtttccatggaacaat
cttaggttacccagttatgtctttcctctacactatgaccttcttatacacccaaatctg
accacattcactgttagtggcctggctaagatcaccgttgttgtcacgcagcctaccagt
tctgtcattctgcacagcaaacacttgaagattacaaagactagcatggagagtaaggtg
ggaagcagcctggtacaacaagatgtactactactggaacatcctgcaagtgagcagatt
gcactacagcctgcagaacccttgaatcctgggaaaaactatactttgtacatagagtac
aatggtaatctctctgaaagcttccatggattttataaaagtagctacaaaaccccggat
ggagaggtcagagttctggcttcaacacagtttgagcccacagcagcacggttggctttc
ccttgttttgatgagcctgccttcaaagccaccttctccgtaaagatgcgacgggaagca
agacacagtgctgtatccaatatgcccatagtaaagactgtggaactgggtggtgggatc
ctagaagaccactttgatgtcagtgtgaagatgagcacatatcttgtagcatttattgtc
tcagactttaaatctataagtgaggtgacaaatcgtggagtaaagatatcagtttacact
gttccccacaagatagaacaggctacatatgctttaagtgcagcggtaaaacttttggac
ttttatgaagaatatttccgtattccatatccattgccaaaacaagatcttgctgcgatt
cctgactttcagtctggtgcaatggaaaactggggcttaacaacataccgagagtcctct
ttactgtatgacccaaagacatccacagcctctagtaaactctggatcacgatggtcatt
gctcatgagttggcacaccagtggtttgggaacttggtgacaatggactggtggaatgac
ctatggctaaatgaaggttttgcaaaatttatggagtatattgctgttaacatcacctat
ccagaactgcaagttgaagacaaattcctagacaaatgtttcactgccatggaggtagac
tcgctgaattcatcccatgctgtgtctacacctgtagagaacactgaacagatacatgag
atgtttgacgaggtctcctatgataagggtgcttgtatcctgaacatgctgcaggactac
attggtgctgaaagttttgaagctgggattataaattacctgcgtcgtttcagttatcgc
aatgccaaaaataaagacttatgggacagtatgactaatatttgcccttcggaaggaaca
gccagtggtaataaggaagaaagcgggttctgcagaaagcaaagccaaaaatctcactgg
acagaggacggtatcattgatgtaaagtcaatgatgaacacatggactatccagaaaggt
ttcccattggttactgttacagtgaaaggaaaacaggtccatttgcagcaggagcattat
cagaaaggagccaaagactccgaatcagctgggctgttgtggcatatcccattgacatac
ataactagtaaaacaaacaaaattcaaaggtttcttctaaaaaacaagagagatgtcctg
ttcttggacgaagaggtggagtggataaagttcaatgtaggaatgaatggctactatatt
gttcattatgaaggcgatggatgggatgcattgataaaactcttgcagaaaaaccacaca
gctgtcaccagcaatgaccgcaccagtctaattaacaatgccttccagcttgtcagtatt
ggacttctaccaattgacaaagctctcagtctgacaaaatatctgagaaaggaggataag
atcatgccggtcttccaggggatggacgagctgattcctatttataaactgatggagaag
agagacatgaaggagattgaagaggaaatgaaggcttacatattaaatcttctgcgtggt
ctcattgacattcagtcctggacagacgatggcacagtatccgagaggatgcttcgcagc
tccctactcctcttcgcatgtttccgcaagtaccagccatgtgtagacaaggccaaggac
tatttcaccaaatggcaggagtccaatggcaccatgagtttgccacgtgatgttgttacg
gctgtctatgccgtgggagcccagacacctgaaggatgggacttcttgtttgagaaatat
caaacttctccaactggtgaaatgcatctgattgaatatgccctgactcttactcaggat
aaggacaagttacaatggttaatggacgaaagtttgaaaggagatcttgtaaaaactcaa
gagcttccccatatggttgtcatggtgagcaggaaccaaatcggtcataagctggcctgg
cagtttctaaaggacaactgggatcagctgactcagaagtttgagctgggatcgcgcacc
cttggtgatatggttgttgggattacgcgcctgttttccacaagagaatggctggaagag
gtgacagaattttttgatttgttgaaagaaaatggctcccaactgcggtgtgttcaacaa
gccaaagagactattgaggaaaacatcaggtggatggacaaaaactttgatcttgtcaaa
agctggctggacaataatcgttcataa

DBGET integrated database retrieval system