KEGG   Nanorana parkeri: 108791207Help
Entry
108791207         CDS       T04897                                 

Gene name
TTN
Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108791207 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:npr04131]
    108791207 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:npr04812]
    108791207 (TTN)
   04147 Exosome [BR:npr04147]
    108791207 (TTN)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108791207 (TTN)
Protein kinases [BR:npr01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108791207 (TTN)
Membrane trafficking [BR:npr04131]
 Others
  Actin-binding proteins
   Others
    108791207 (TTN)
Cytoskeleton proteins [BR:npr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108791207 (TTN)
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108791207 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Ig_6 Tissue_fac Pkinase Receptor_2B4 C1-set fn3_4 Pkinase_Tyr Titin_Z Adeno_E3_CR1 Ig_5 Ig_C17orf99 THB PPAK SusE Ig_4
Motif
Other DBs
NCBI-GeneID: 108791207
NCBI-ProteinID: XP_018417116
Position
Unknown
AA seq 34791 aa AA seqDB search
MALQAPTFIQPLQSVVVLEGSAATFEAQISGFPVPEVSWFRDGQAISAATLSGVQISFSD
GRAKLVIPAVTTANSGRYSLRAANGAGQATSTAELLVTAETAPPNFTQRLQTTTVRQGSQ
VRLDVRVSGIPTPVVKFYREGAEIHSSLDFQILQDGDLYSLIIAEAYPEDSGTYSVNATN
NVGRATSTAELTVQAEEEIPAKKTKTIVSTAQISQTRQARFEKRVEAHFDARSSTTVEMT
IEGQLPHKTPPRIPPKPSSKSPTPPVIPTKVQMVRQQSPSPIRHSASPVRHVKAPIPSPV
RSVSPAGRGLSTSPIRSVKSPSPARSALTLAGAEVPPPWKHEVFVSSSTSQMKTEQKWEA
REQVTVTGVEQREVYGPGKTVAVATVVAAVDLARVREPAPSTIEVTAKRTAMSAVQIQPV
HEQVRKEAEKPVSTVVVSTDKRKQETVTRTVEGVAAKREQIHAVQEQMNYNSEVGMAVAT
VLAAVEQARKRTLRGADVQAISQMPVKKDEIGTGKKAGAVATVVAAVDQARVRLPGYTEG
GYAEETALQYEYKEHVSARKTVEFSPERQVVTKPIKAPDVHVPKVVHVEHVPTPVPQIKR
IPEPPTVPVVQVEQTISHTPVPHFTVSKVTVPKPEHTHEVSIAGSAIATLQHELTAVSQK
ITKHVEAPHLKLAEARATPEKIVSQPYPLAEPADAYKSRFDAQMKRDIGLTVTGGYSRDE
RFQYQYEVGYQETLAEEAAQVPEPAEVPFSPPTIVSGLKNVTVLEGESVTLECSIAGYPS
PTVVWYREDYRIENSIDFQITYEQEIVRLVIREAFAEDSGRFTCTANSEAGTVSTSCYLL
VQVSEEYEARETVTEKMTEERQXLYNERDVNMNSISXLSHXLSFCRYTEEQKMEIEVTAP
AETGEGVVPFFIRKPTVQKLVEGGRVIFECQIGGNPKPHIYWKKAGVPLSTGYRYKVSYN
KDTGECKLEISMTFADDAGDYSIAIRNKHGEATETISLLEEAEYDHYMRMHEEPTPFVPE
PKVAEAAPTLYRTEYDKEYEKEHALIRKKMAKDTTIVKTTIYTEEYQLTAFEEKLIKEIE
YRIIRITLEELLEEDGEEMIVDIEESEIIESGFDIRLKSYQILEGMGVTFHCKMSGYPLP
KITWYKDGKRIKQGGRYQMETLQDGRASLRISVLATEDEGIYTALASNVKGNSICSGKLY
VEPAALTGGLAYIPAPEAVKKIRSVSPRSPSRSPARSPGRSPARRLDETDESQLERLYKP
VFVLKPASFKCAEGQTARFDLKVVGRPMPETFWFHNGQQIVNDYTHKIVIKEDGTQSLII
VPALPTDSGEWTVIAQNRAGKTSVSMTLTVEAKEHLQRPQFVEKLKNVSVKEGSKLEMSV
RAAGNPNPDIVWLKNSDIIAPHKFPNIKIEGAKGQAALKIESTVGHDAAWYTATAINKAG
RDTTRCKVNVEVEFAEPEPERKLIIPKGTYKAKEIAAPELEPLHLRYGQEQWEEGDLYDK
EKQQKPFFKKKLTSVRLKRFGPSHFECRLTPIGDPTMVVEWLHDGKPLAAANRLRMVNEF
GYCSLDFEVAYPRDSGVITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRRGMQRIE
EMERLAHEGALAGVTEDVKEKQKPEIVLFPEPARVYEGEIARFRSRVTGYPQPKVNWYLN
GQLIRKSKRFRLRYDGIYYLEIVDCKSYDSGEVKITAENPEGVTEHVVKLEIQQKEDFRS
VLRRSHEPKVAPPSAEAGKVPFEVKKVTEPGAKEFVKLKRIERITHDKISEESEELRSKF
KRRTEEGYYEAITAVELKSRRKDEAYEEMLKKTKDDLLHITKELTEEEQKALEEEGKLTI
PTFKPDRIELSPSMEAPKILERIQSQTVAQGGEAHFCVRVVGKPDPECQWFKNGVKVERS
DRIYWYWPEDNVCELVIRDVVAEDSASIMVKAINVAGETSSHAFLLVQGKQLIKFTEDLQ
DLTAKENDSMATFECETSEPFIKVKWYKNGVEIHSGDKYRMHSERKAHFLSVLTIDMSDA
DDYSCVLKEEESMRTTAKLIVEGTPIEFTRKLEDIEVQETQSGELECTISLEDAQGKWYH
GDTEIQSDSKHVITSRRGRHVLTIKDVTKEDQGEYSFVVAGKRTTAKLKVKPRPISILQG
LADQKVCEGDIAQLEVKVSLENAEGVWLKDGVEIQPTDRIHIVIDKNSHMLLIEDATADD
VGKYSFTVPGLDLSTSGRLSVYSVEIVIPLKDVHAIEGTKAVLECKVSVPDMTSSKWSIN
EHPVKLDDRVQTIAKGAKQRLVFSRTHASDKGQVKLLIGKVETSCNLTVEKITIIKGLSD
QTCTETQNVTLQVELSHSGIDALWLFKNDELKPSPKYKIESKGKIYTLTITNMMKDEEGQ
YTFFAGEQQTRGKVTVSGGAISKPLVDLTVAESQKAVFECEVANPDSKGQWMREGKPISF
SDSIKSETIGRNRQLIIPISKLEDIGEYTYQVATSKTSAKLKVEAVKIKKTLKNQTVTET
QDAIFSVELTHPDVKGAQWIKNGVELESNDKYEIIVDGPVHTLRVKNCVVPDESVYSFKL
GKVGANARLHVETVKIIKKPKDVTALENTPATFELSVSHDTVPVKWFFKNVELKSSDKHK
IVSERKVHKLVFQNIIPEDAGEYTAVVGQLECKVKLFVETLRITKTMKNIEVPETKTASF
QCEVSHFNVPSIWLKNGVEIEISEKFKIVVQGKLHQLIITNTSSEDSAEYTFVCGNDKVS
ATLTVKPILITSMLKDINAEEKDTITFEVTVNHEGITYKWLKNGVEIKSTERCQIKAKQY
SHSLTIRNVHFGDGADYSFVAGNAVSKATLYVEARHIEFRKPIKEIKILEKKRATFECEI
SEPDMLVQWMKDGQELQITDRVKIQSERYVHRLVIPSARMSDAGQYSVVAGGNMSTANLH
VEGRDVRITTAHKEIQAVERQRAVVEFEVNEDDVDGRWLKDGIEINFHVEERYEYLMERR
VHRMSITETRISDSGEYTFSAGRNRSSVTLYVNAPEPPVIIQKLEDVHVESGKPARFCTV
VSGKPQPTVAWFKDSTQLSPGFKSKFLHDGQEYTLLLIEAFPEDAALYTCEASNDSGMAS
TSGTLTVEVPEVVSPDLEAPAYPPEIITPLRDTITAEGQPAIFQSCVSGTDLKVSWYSKD
KEIKPSRFFKMTQFEDTYQLEIAEAYAEDEGTYTFAASNSLGQVSCTANLRLEALERVLQ
ERIEQQIELEVKDVSSSYVISTEEDTTETFSSGLQLKPKTRTLASMPESSIYSSKLEFKK
EASIPVFIKQLSSLDARVGDAATLSVIVSGFPKPSIYWRHNGEELSTSERYKLLYDGDEY
ICLISCVETNSEGEYTCIAINEHGETICSSYVTVRQRESIDISKHLETTLTLNGQSKDDN
QLIAPTFVKPLQSVCCIQNDNAVLEYELTGNPKPKVRWFRKNKQILAGKRHAICLKQDGI
GSLTVHKCQQEDSGPYTCKAFNSLGKTSCTAELSVVPNPSIADKESQIKVTKSYKKSSVQ
ESTETRLYAVKLPGEAVSEQEHSTMLYTIGIEGKYSTHSEEGDSLQEVINLEQQLVQLNP
QPNEYMLLATSAVTELTDVSEQNVRIIISPVLEELDRPKSQSLHLAVTEESTLADKEREV
NDNYLCTPQLGLAHEEKSRHILVTAEEKQQISCDTTAAILVGETTTAVSTAGAKDVLHTH
SVEIVEEFIKEQLLGDEVAQLLQMEKQNPSSKVDLVFLEPLVTPVVDSQHILVREQNLHF
KKAQEEKAMLIKDQPIKSGFMLEEKHQLPYEQTLSIQERDAEEVAKCDLELRQVMHLHVV
EPHTQLPSEETFCFVMPSEDQADITKSPVFLLSSLSDDHRPILCEDTSIIKDFSAEVNLT
FSKEPPPVLNLQTIQSELLLPKEDKVIIEKLESNTALTKMEKFYKRTLHVEDKSIFSGER
IKELQILAGHVQPISVTERQQHKCAFAMEAVLLLSKEELVATEKEQRAVVQKDDFQPVTK
LCTTVESRTIADGYADFVPDIDINTCQVTEELTRPIETTCIENYGVPIQSVIPLDEAQQD
YASRIQEGQSVSLPLAVEEKQAIPEEHSQTAERSATEILNVETQPKDLLRLHDVFAANIL
HKEQLLVSEDLKHFNLEIKGHVRRALYSALINKSDILSAEILQNIQNINVKSIKVTKEPK
NTLCTYVITSNCSIEEVTLSLPRVYPQSIDLKSELKTAFQAVIFEEKHILEAGRPESIIT
MQEKAFIAIEQQQKMSTATVADKPSFCDAYNSVNIKTEGSETYEQSRAKQSPSAVEIKDI
GAAACTDEVTFSTVSIQKQEQIVKKRETRQEIYEDELLKESATPLIRQSLLDYTANEGDC
VTFSTVINSAKTVNWYFNDRLLSSGIEFKCSQHTDTYTLVISKVQMDLHQGEYICEALND
AGKSTSAAQLTVVKRAPVLKKRIETVEVAVGYSAFFTCETEPAPNVKFQWFKSGREIYES
DKYSVKTSSYISTLEVLRPQVVDCGEYTCKASNQFGSISTTATLTVTEAFPPSFITRPES
VTSFVSKKAKFQATVSGTPVIDTIWQKDGLPISLSESIQISAINNKHVLEFLNLTTSDKG
IYSCKASNKFGTDGCQAELIVIDKPHFIKELEPLRSAVNKTIRLECQVDEDRKVTVAWTK
DGHKLLPGKDYKIYFEEKVASLEIPVAKIKDSGNYVCTATNDAGSNSSSSVVTIREPPSF
VKKVEPSYLLRQGESAHLQCKIKGSPDIHVTWYKNNTAITPSEMFRMTFHNSDAVLDITN
MKVDDSGSYTCEALNDAGCESCTCEIIVKEPPSFIKTLEPAEIVKGSNTTLQCEISGTGP
FEISWYKDKKQIRSSKKYRLIYQKSFACLEISSFNSADVGEYECVVANEVGKCNCSAPYR
LKEPPSFVKKIENVTAIVGNNVSLQAVVKGSEVIMVTWMKGRDVVREDNKVKITFDNNIA
TLHISSVQINSAGKYTCVAENEAGSQSCFGELMVKEPAKVVEKAELIQVTAGDPATLDCT
VSGTPELKVKWLRQGKEITSGKKYRISFKNNVASLKFYAAEIQDSGEYSFEVSNDVGSSS
CKITFTVLDRTIAPSFTKALQDIDNVVNVPCRLECKVSGSLPMKVAWFKNGEELTPDKYK
ISFVEGTAFLELSRLELSDAGIYTCKATNSAGSKESKGTLSVKEPPSFLTKPDSQDTLPG
STVCLKTTFKGTPPLSLRWFKGVEEIKTGGSCYIAKENTSSSLELYAVKTSESGNYVCKV
SNVAGTVECSANIFVKEPATFVEKLEPSQLFKKGDAVQLECKVAGTPTISITWFKNDKKI
KESDACSMSFLNSVASLSIYSINLEDIGEYVCQAKNEAGTDTCSCAVIVKEPPSFVKEFQ
NVEVLRDSDVILEGALVGSAPFEISWFKDNKPIRSGRKYKTFFQDSLLSLSILRFDSMDT
GDFQCRVFNDVGSCLCSSLVTLKEPPTFTRKIENLSSLIGGMVAFQCSVKGSQPMSISWW
KDNDEVMEDENLKSIFKNNVATLHITSVKRNRGGKYTCEAKNEAGIQRCSAVLAVKEPAT
IIDKAISVDVTEGDPATLQCKFSGTKEITAKWFKDGKELKLGPKYKISFTENVSVLKIIS
ADKNDSGEYTFDVQNDVGRSSCSASVNVLDLIIPPSFTKKLKKMDSVKGSFVNLECIVSG
SHPITVKWLKDDNEIQPYGKHKYSFHDNIAFMEINELEGSDSGTYTCIAINKAGKGQCSG
YLTVKEPPYFTEKPLSQDTLPGSRVQFKTVLSGTTPMVIKWFKDSKELLSGANRSVWKDE
SSSILELFSAKVADSGSYTVQVSNDVGTVTCKATLFVKEPPRFVKKPSPILLLRNGESTT
FQCLIAGTPEIKVIWYLDGNDITTSDRYSISFIDGIANLDIINSTIEDTGMYVCEATNEA
GSESCSIDVKVKEAPTFKSVFEPADVVKASDVKLFCEVLGTPPFDVTFSKNKKEIRSGKK
YSLVQKDSVFELHIFNVDYSDAGEYQCTISNEAGGCHCSASVHLKEPPTFVQKIENATTI
LGSAAAFQCAIAGSDPITVSWIKGDKVVEQDDNTHITFENNISTLYIRTVDASHTGRYTC
QASNESGTEKCFASLIAQEPAEIVDRPKSVNVTERDPVTLYCTVAGTPELQVKWYKEGRQ
IMPSRFFMLSFEDNVSSLRIQSASKEDSGEYMIKVENDFGSSSCTAFVTVLDQAIPPSFT
KKLTKMDKVLGSSIQMECKVAGSLPINAQWFKDGSEILHSAKRRLVCHENIVSLTIADLD
VSDNGNYKCKVMNVAGRAECSAILTVKEPPSFILKPESQKAIPDSLVDFKVEVKGTPPFS
IKWFKEDMELFSGPKCFLGMEGSIGFLNLFTVDGTSTGRYTCQVTNDVGSDTCSTMLVVT
EPPKFIKKLESTKVTKQGDSVRCECKISGSPEIKITWYKNDSEIKANEKYMMYFIDFIPV
LEINNLSIEDSGDYTCEANNDAGSASSSIKIVVKEPPVFSKKPSPTEVLKGVDVSLECEL
LGTPPFEVIWFKDRRQIRSSKKYKVTSKNHLASVHILNVEAPDIGEYHCKASNDIGSDTC
ICNIKLKEPPKFVKKVESVTVILDEPLELQGLIEGSQPISVLWLKDKEEIVRESENIKIS
HFENLATLQIRKAEPANAGKYICQIKNDAGMRECIANVSVLEPAKILEKPEPVRVTAGDV
CLIECIVTGTPELSASWFKDGKELTSSQKYKISLSNKVASIKIMSTDKSDSGEYTFEVKN
NVGKSTCTATVDVLDRVLPPSFTKKLKETTAAVGSSIQMECKITGSPPISITWLHNGSKI
FSGDKHEPDFSDSLCVLKINNLESSDGGKYTCVASNITGTDECSASLTVQEPPSIVTKPE
PLEVLPGMKVSFRCVIRGTPPFKVHWFKGSSELISGTACLIKFKDSDSILELYDVDTAHS
GDYTCVVSNDAGKDSCTTQLVVKEPATFVKKIKDYNVETGKPFILESTYTGTPPIYVTWE
INGVEIIQTERCNLTTTEKSCILEILSSSKEDDGEYTCRVENEAGQDICQSMVTILEPPY
FITSIEDVDVTVGDSTSLQCQVGGTPEIVVSWYKGDTKLRSTPGCKVYFSNNVATLAFSK
VDKNDSGEYICKAENSVGSVSSKAVFTVQDRQLPPSFARKMKDLEVTLGQPVKFDCRING
SEPIEVSWYKDGVPLTEDINVQMSFVNNVATLRILELEKGHAGLYSCTATNAVGTASSSA
KLTVSEPKKPPIFDKKAESVGAVLGESAGFECLVSGTQPIKVLWTKDNKEIKTGGNYNIS
YIGNTAHLRIIKVGKGDSGIYTCHATNDVGKESCSAELSVKEPPKFVKKLEPSRTVILGG
SAHFDCKISGSPEIRVVWYKNDTELRPSEKLNLSFADNVALLEINNFSPEDSGDYTCEAH
NNAGSASCSTSITVKEPPIFVRKPSPVEVLKGVDVSFECELLGTPPFEVAWYKDRRQIRS
SKKFKLTSKDTLASIHVLNVEPADIGEYQCKAVNEVGSDNCVCAIKFKEPPRFVKKLSDV
TCFSGEITEFQAVTEGSQPILITWLKDKGEIVRESENVRISYVNNIASLQIACTESSNAG
KYTCQATNEVGSRECASLLSLIEPARIVEKPEPMRVTAGDTCSLECTVAGSPELITKWYK
DAREIRNDHKYSITFSNKRSTLKILSANREDSGAYTFEVMNDVGESSCTVSVDVLDRVIP
PSFTRKLKDTNSVLGSSTRLECKVSGSLPISVSWYQNGNKIVRSDKYDITFTDNTCALTV
NSLGAADVGTYTCEAANVAGTDECSASLTVQEPPSFVRKPDPQEVLPGSNVTFTSVIKGT
PPFKVNWFRGSSELVQGPNCNISLQNSFAALELYNVDSIQSGDYTCLVRNDAGKDSCTTH
LLVKAQATFVKKLNDTSVESGKAITLECTYVGSPTIMVTWKKNGREISQSERCSVTTTEK
SCLLEIFNATQGDDGEYTCLVANEAGQDTCSALLSILEPPYFISPLEQVEVTIGESTSLQ
CQVGGTPEIKVSWYKGDTKLRSTPAYKMQFKNNIATLFFNKVEKTDSGEYICKAENVVGS
ASSSALFTVQERKVAPSFARKFKDVQETIGLPVTFDCRINGSEPIEVSWYKDGVLLRDGN
NVQTSYIDNIATLHILSTSVDHLGQYSCTATNPIGSASSSAKLILTEPKSAPVFDIKPES
INVPLGEAAVFECHVTGTQPIKVSWAKDNREIRPGGNYKITFTENRAQLKILKVSKVDAG
AYTCYASNEVGKDSCSASLDVQEPPRFVKKLESSKVIKQGDSDRFECKISGSPEIRVVWF
KNDAEIQPSGKYAMSFVDSVAALEITDANIDDSGDYTCEAHNDAGSASCSGSLKVKEPPV
FIERPEPVLTLKGLDVTLKCQLNGSPPFEVSWFKDRREIKSSKKFKIITENYLASIHILK
VDAGDIGEYQCKAANDVGSDSCLCSIKLKEPPRFVQKLENFTSVVGEPAQLQAVVDGTLP
ITVAWLKDKEEVVRESENISFSFVDNIATLNFASIKPQNTGKYTCQIKNEAGAQECFSSL
SVLEPAIIVEKPQPTKVTAGDSCTLECTVGGTPELITTWFKDGTELTSDEKYKVSLFGKV
ASLKILSTGTNDSGEYKFEVKNNVGSSSCTAIVDVSDRIIPPSFTRKLKETYGVLGTTTS
MECKVSGSPPIVVSWSFNGSEIVSGDKYQTTLTDNTCTLKVSDLAPLDTGKYSCHATNVA
GSDECSAVLSVREPPSFMEKPEPVEVLPGATVTFAGVIRGTPPFKISWYKGSDEILPGSN
CNITLTESLAVLELYNVNSLQSGEYSCHVSNDAGRDSCSTQLFVKEPAAFVNKLTNYQTD
TGKPIILECSYTGTPPIYVTWKKNGLEVSQSERCSITTTEKSCILEYSSSTNDDDGTYTC
HVENEVGHDTCQATVKVLEPPYFITPLEPVEVTAGDAASLQCQIQGTPEIKVAWYKGDTK
LRPTNTCKIHFKNNVATLVFSQTDVQDSGEYVCKAENPIGTASSAALLTVTERIVPPSFA
RKVKDIQETVGLQVSFECQIVGSEPIEVSWYKDGVLLRDDYNIQTSYIDKTATLQIFQTD
RHHAGQYTCKASNFVGTATSNAKLILTEGRNPPFFDVKPSPVDVPVGDPAEFGCHVTGTQ
PIKLTWTKDNKEIKTGGNYKVTQLENTAKLTILKTDKADSGQYTCSATNDVGKDSCSVKL
NVQERKVVPSFTKKLSETVEETEGNSFKLEGRVAGSPPFIVSWLQNNQEVQQSVNSEISF
KNNVVLLQVKKSSQANAGLYTCKVSNDAGSALCTSAVLIKEPKKPPVFDIPLSPVTVAEG
EGLQLSCHVDGSQPIRSQWLKNGREIKSSNTCSVTFVRGTATLELKAAAKGDAGDYVCKA
TNSAGSESTTSKVTIKEKASAAAAPVKKAAIEGKLFFVSEPGNLKAPEKGTATFIAKVGG
DPIPNVKWMKGKWRQINHGGRIVVQQKGDEAKLEIKDVTKTDSGQYRCVAFNKHGEIECS
TNLSVEERKQESFDGDLRAKLKKTPTKKKEEEEEKAIDIMELLKNVDPKEYEKYARMYGI
TDFRGLLQAFELLKASREEESRRMELGMEERSHTEEQEFDELVSFIQQRMSQAEPINLVK
DIEDQTVQTKKEALFECEIKINYPEIKLSWYKGTVKLDTNDKYEIGIQGDRHHLRIKNCQ
LEDQGNYRVVCGPHIASAKLTVIEPIVIKPLQAHSIKEGHSSTLICEFSIPNVNSQWYRN
GKVIDPRGRYQTEVDEKIHKLTIQDVRTEDQGQYTCRFEKLETTADLFIEAEAIQFTKTI
QNIVVSEHESATFECEVSFDDAVVTWYKGTMELQESAKYSFRSEGRWHYMTIHNVTAEDE
GVYSVIASLEPRGEATSTAELYLTTKEMKLELRPPDVPDTRIPYIPAPVEEEFITEAPKA
GVKVPRDVTDDGEAVPPTKIALVGKKQKVPAPPAPPFPAPPAKVPAKPRKEDEVKIITVA
KKKEEIYQKIHEPEPSYEVEEYAEEEEAYEEYGREEEVYERHVYEEEKEYYEEQVYERKK
EYYEEQVYGGKEQYYTEVIEEEIPEIRISEAEYKKPGVTAVPEKRATGDFYYEHQVEETA
VVTAPTVHEKMVVEERRAVSVSRTEEISEAVPVEKVPAPVPKKEEAPSARDARKKPVPEE
KVPAAAPKKPEVIPSKVPEAPKRPVPEEKIPITVPKWEEPPAAVPELVKKPKIAGKMPIA
TPQKPEASPARVSEIEKKQEEKIRIISKKVEAPAPTVPGVPKKPIEEEKQIIIFAKKEVT
TPVSVVSRKVKEAQVVTVKREEKRGIIERPSFKDKEVYEEVYRKQEATFKERVYEEREEI
YEEEIVSPEEEIYEEPDGEVDEIYTTRGYIYKEEAPEEQYEEAAEEYYVEEAPEETYEEE
VTREEERYEEIIYETRQTAYEEKIYKPIEAYEEPEAEKESFYQAVDVVYEEKEPEKPKKV
IPAEKVPTVVIKKEKITVERVPGEPEKPILKGREAITVSKKDVAHIEVSKDIKKVVTEER
LPEEAPKVKVPAAKVPEKPKIPVPEERLPTPPAKKEEVPPSKVPEVHKRAIPEEKVPAPV
PKKEEVQPPKVPEIHKKTLPEEKIVPKKEVPAPPVYFFIKFPQVVKKIEAKVPVPVAKKD
EAPPAKVPELRKKPVPEEKVPVPTPKKEEVAPPKVPEAPKKIIPEEKVPKVFPEPPTPKV
PEPPKLPTLKEKAPSIQKKPTPVEVAEAPPKVAPEQKIPTPISKKEVPPAPPPPSKVVEV
PRAVEEERPPAFVHKKEVITTVEVVENVTLAIEVPDVPPPLVEKKRIPPKKVPEMLQQPL
PEEKVRRTIHKKEIVPQAEEHLKEEKLQQTLPKKEIVSPAQVEMHPKAIRQEEQLIVSER
KTVLAAEVPEAPEMRVPEKKILKPKKDAMHTAGEIPKEAEEKFPRVVSKKEVIHHVEVSE
VPDKIAPEEKMFTRPTKEATPSLEVPMKVPRKPIDEEKKTVTDYTREVISSVAALEVPTR
IPSEENKQVTVHKHEVIVSAEEVSKKPSAKGKVPASRKEKTSYVEANISERGGSEEMPQI
AVSKREPTSYEQDVPKTCRTEESPHIGVSKEGTPSSLEDSQIRIIPREKSLTLITKREVT
SHEEAEIQEKQSLFKKPEKIILKKEVTHKQVFDEQWELVQEEKIFTKPREIDVYTEEVQK
EVIPEDKFQIAAQATLETEYHYIEELKVPKKPSPEEKPVIAGQVPGRDANSIKKATVVQK
TPKAKDRPTLTAPEKKVVTDEEEVPRQLDSEDKILISLPEKEVISAEKAKLQFVIFKIVE
QPQPTPLKEKAPTAITKKEVKSPAEVPATPKKPIPEQKPAIPAAKKEVAAPVEAAVGKKP
VPEEKRLHVPKKQIVPSVEVLPTKPVVEEKRSVAVPKKDVEPSVKDVQKKLITDEKKVII
YEHTEVVPSVKVPTQQKKAIEERTTVRVAKKGTVPVPDEKPAFGKKPYAKAPPLTVADVV
KPVTPHEEVPVILSEEEEEYELEDEDYEFEKTTIETPSPLKKEETFRIEVPEVKKKIVPG
KPTPAEPEKVELKPFKVPEPEKKVFTKPKPGIPPPRKEEISFKKVLKPAKKEVEEPPAVK
PVEKVKKPEPTVEKKPEVPEVQKKKLPEVTPAVKKEEAKHEPPKVPAEAKPSPVTMSPKE
PSPVQAVPSPKGDEAAITAPVTTPVFGKKAVTEKPGVPIKIMQKGKMLTEESKVEAVRRV
PFLSSDIFIPIEEHVSFKAERLFTDVIEEERKILKKEAEKVHITSEVKVSEHWESEEIEY
MEEITEEEDNAKPEKDLKTKGIVEDKKKRHEKIIGHEKDSVELAPEKLITEIKSKLEEKV
EGKEKKPAEKKKDKEIIAVLPEKATEKIKEVKKEKKDEQLRKISKKIPQHELSISTGEEE
EKVESSSAESDEELEAHEAQIKISTKKTKETKFHKPVEKDKKIIQKAIPKEPDASYKGTV
DKKAERYKIIGNKIPQHDPTISSEEEEKLSSAESNEIFDDQEKQIKIPIKKSKEVKLDKA
KEKAKKIIKKDITKKPDVSYKETVDEGVETSSAESDELEIQDEYVKKPSSKVKEPKLDLT
VEKVKQIKKIPTKQPFVISKKAATEKIELSSAESVELLEALDEHAEKPSKKIEEARADKI
IDKTKKVSKKVPIKEPSMSPEKIVYERKEISSVESQESLEAPDELLRHKATKKLKEAEVA
PARPKIITRDTKTDMVKILHKDEKADLQRGEEGGTWVEKVDAELGKKIPDKKGIEDLKKK
EHLFKDIVHKKDITDSKTLTDTIKTPITHFVNAKEEKVTGVHAVIPTVEISIEEPPSVDE
ISLYDSAKKIEQDKKVFGESKVTVGDILEQPTEKVKKIAKSEKKAHPQESPTEPKKESLS
PLQQIRRLKTPIDKDKISIKVQPEEKKPVIPVLKKVEKIKTPLPAEDVSLSGKGISTKDD
RSLKVISRTSTPTDRRKVEQNKSLGKETPQDESSLKVISRTSTPIDRRKVEQKKSSDKET
PLLRSPIKDKDSASLKTETDSNEMEELEEDETWEQELESTSEHTDYGSEEDILSEDSGQG
RKRARETPAKAIGRRDTKTPKDEAPRGKLPLKGVKKTPSPLDADKKKLRPGSGGDKPPDE
PAFTYQLKAVPLKFVKELKDIVLQEAESVGSSAIFECLISPSTAITSWMKDGSNLREGPK
HKFISDGKDRKLHIIDVQLSDTGEYTCVAKLGNKEKTSTAKLIVEELPVKFIKTLEEEVT
VVKTQPLYLSCELNKDRDVVWTKDGKKLSEASPGRYQTNIIGLNRTLTILAADDEDAGVY
TCTVENADIKCSSNVKVVEVIRDWLVKPIRDQHVKPKNTATFVADIVKDTPNIKWFKGDE
EIPLEPNDKTELKKEGNKIYLIIKNTGPEDVAEYSVEVEGKRVTAKLTLGEREVDLLKPI
EDVVIYEKESASFDCEISEADIPGEWKLKGETLRPSPTCEVRAEEGKRFLTLHKVKVDQA
GEVLFQALNAATSAILTVKEIELDFAVPLKDVTVPEKRQARFECALTREANVIWSKGPDI
IKAGDKFDIIADGKKHILVINESAFDDEGEYTAEVDGKKTTAKLTVEGIRLKFISPLKDQ
TVKEGETAHFDFELSHENMPVTWYRNDKKLHTSRTILISEEGKTHKLEIREVTLDDISQI
KVEVKGLHTSANLKVLEADPYFIVKLQDYTAVEKDDITLECELSKDVPVKWFKKGEEIKA
SKTVTIKTEGKRRILKIKKVEEKDKGDYECDCGTDKTKASVNIEARIIKVERPLYGVEVF
EGETARFEVEISEPDVHAQWKLKGEVLSPSPDYEMIEDGKKHVLILYNCKLDMTGEISFQ
AANAKNAANLKVKELPLIFITPLSDVKVYEKDEARFECETSRLPKTFRWLKGSQELGEDE
KYELVAEGTRHALVLKSVAFEDEAKYMFEAEDKRTSGKLIIEGIRLEFVTPLKDVTVKEQ
ETAEFTIELSHENIQVSWFKNEQRLHPSKLVSMHDEGKFHTIKFKDVTLDDTSLIKVEAM
GKSSEANLTVLEGDPYFTTKLSDYTAVEKDDVVLHCEVSKSKAPVKWFKDGQEIIPSKSV
AIKADGKKRIITIKKASKKEIGEYSCDCGTDKTIAKLNIEDRNIKVVRPLYSVEVMETDT
ARFETEISEEDVHANWKLKGEALHSSPDCEMKEEGKKHFLILYNVRMDQAGGVDFQAANA
KSSAHLKVKARLIGLLRPLKDVIVTAGESATFDCELSYEGIPVEWFLKGQKLESSDKIVT
RAEGRVHTITLRDVQLQDAGEVTLTAKDFKTQASLTVKEAPVEFTKPLEDQTVEEEATAV
LECEVSRENAEVKWFKNGQEIHKTKKYDIITEGRVRKLIIHGCTLDDARTYTCDAKDFKT
SAFLNVEPPFVEFSKPLTDLEVKEKETARFQCEISRESAKVRWFKDGVEIRKGKKYDIIS
KGVTRALVVNKCVFEDEAEYTCESKMARTSGLLTVIEEEAIFTKNLPNIEACESESVKLV
CEVSKASAEVSWFKGDDDLPDGGRYEHIAEGRKRILMIHNIRLDDAGEYNCRLPNSHTTG
KLGIKELAAEFVSRPQNLEVLEGEKAEFVCSVSKEAFEVQWVRNDTILEAGDKYDIISDG
RKRILVVKDAVPKEDEGTYAAMIGQSRAPAELTVIERLRIITPLKDQQVKEGQELVFNCE
VNTEGAKAKWFKIDEAIFDSPKYIMVHKDLVYTLRIRDALLDDQANYSVSLTNHRGEHVK
SAASLTVVEEDLRIVEPIEDIETMEKKSVTFCCKVNRPNATVMWMKNGQEVVLDRRVLYK
VDKYKHSLIIKDCGFVDEGEYTVIAGQDRAVAELLITEAPADFVQHLQDQTVIEFEDAVF
TCQLSKEKAAVKWYRNGRELRENKKYQFEKDGSLHRLIIKDCRPEDECEYSCGVDERKSR
ARLFVEEIPIEIIRPPLDVFEAPGSDVIFEAELNKDRVEVKWLRNNMIIVQGDKHQMMSE
GKIHRLQVCEIRPRDQGEYRFVAKDKDARAKLELTAVPKIKTADQNIVIDAGKPLTMAVP
YDAYPKAEAEWRRKGETLSDVHVDTTANATSFRIPETKKADKGHYTIILQNKHGKAEAHI
NLDVIDVPGPVRNLEVIDTYDGEVSLAWEEPESDGGTKITGYIVERRDIKRKTWVLVTDH
ADSCEYTVTGLQKGGVEYLFRVSAKNRVGAGEPVETDKPVEAKSKFDVPGPPLNVAVCNV
NRFGASLTWEPPEYDGGAEITAYIIELRDRASIKWDTGMITKPDELGATLNDVVENKEYI
FRVRAENQAGIGKPSAATPAIKIRDPIDKPSPPNNLTHANQTKSSVQLTWEPPLQDGGSP
VLGYIIERCEEGTDKWIRCNVRLAPDLTYKVTGLKAGANYLYRVSAENAAGISDPTESLG
PLTADDPQTPPTLDLSAFKKGLEVIVPEPLKIHVPITGYPTPTAAWSVNGTVLESNDRVK
IETTIAFAELVIVPSERSDKGIYTLELTNPVTSISGEIYVNVIARPSAPRELKVGDLTRS
SVNLSWEAPENDGGSPLTGYLIEKREVNRKTWARVMDNVIDQEFTVSDLIQGKEYLFRVS
ACNKCGPGEPAYIDEPVNLSAPATVPDPPENVKWRDPTGKGIFLTWEPPKYDGGSRIKGY
IVEKCHRGTDKWEICGDSVVETKFQVDNLTEGQWYAYRVKALNRLGASKPSKPTDDILAT
DPKEAPEIFLDVKLLAGLTVKAGTKIELPAAINGKPEPKITWSKADTLLRIDTRINIESK
PGHSTVIISESKRSDFGTYIIEAINTSGRATAVVEVNVLDKPGPPAAFDISDITNESCVL
TWNPPRDDGGSKITNYILEQKAGDSEVWHKLSSTIKETRYKATKLTPLKEYIFRVSAENM
YGIGEPVQSLSMVAKYSFDPPGQPTRLEPSDITKDGVTLTWNEPDEDGGSPITGYWVERL
DPETGKWIRCNKTPVKDPTYRVKGLTNKKKYQFRVLAENLAGPGKPSKETEPILIKDPID
PPWAPGKPTVKDVAKTSAFLNWLKPEHDGGAKIESYVIELLKTGTDEWVRVAEGVPTTEH
FLKGLMEKQEYSFRVRAVNKAGESEPSEPSDPVLCKERLNPPTPPRFLEVINITKNTADL
KWTPPERDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCSVTPLSEGSLYVFRVAAENA
VGQSDYCELEDSVLAKDTFTTPGPPYALTVQDVTKRHVELKWEAPKNDGGRPIQRYVIEK
KEKLATRWVKAGRTTGPECHFKVTDVIEGTEVQFQVRAENEAGVGHPSEPTDMLAVEDPT
SPPSPPLELHVTDASRDHIAIAWKAPEKNGGSPIIGYHVEACPVGTEKWMRINSRPIKDL
KYKTEEGIIPDKEYVLRVRAVNAIGASDPSEISENVFAKNPDCNPTIDLKTQDIVVVEGE
KLTIPVPFKSVPAPTINWHKDGKEFKIADRVSAKSDYTSATLEVSNIVHADAGVYTITLE
NKIGSTTGSINVKVIGLPGQCKDIKAVDVTKNSCKVSWEPPEYDGGSPILHYVLERREAG
RRTYTAVMSGENKLTWNVKDLIPNGEYYFRVKAVNKIGGGEYLELRNPIIAEDAKQRPDP
PVDVDTHNPTSKTITLTWKPPQYDGGCKIMGYIIEKIPKGGEKWERCNDSLVPVLSYTVK
GLEEGKEYQYRVRAENIAGVSEPSRVTPETKAVDPMDPPKVFLSGSLQSGLSVRQGDEIT
LDAHITGSPYPTITWLRNDEVIRPEEIKKRVDKIVPRRKKEAVVDEPFHLSLPERMNVDN
SRQGESELSVRDSIREDYGIFTIKVENDHGVAKASCEVNVLDLPGPPVNFKFEEARKNSV
TCNWEPPLDDGGSEIMNYILEKKDNSKAEIGWVTVTSTLRHCKYPVTKLIEDKEYIFRVS
AENKFGSGPPCVSQPLLAKDPFTPPDAPEKPEIDDVTANSMLVKWKEPKDNGSPILGYWI
EKREINSTHWARVNRNLINALEARADGLFEGLTYIFRVCAENAGGVGKFSVPSDPKTAQD
PILLPGPPIPRVMDTTSSAIELEWNPPLYNGGGEITGYFVDKQLMGTNEWSRCTDRPIKL
LKYTVKGIREGADYKVRVSAVNAAGEGPPGVTEPITVLEPQEPPIVELDLSVKDGIQILA
GQDLRIPATVFGRPAPKIKWTVEDGELNKEKAEIINEGNSSVLTIPSAERKDHGRYIITA
SNESGTKSAATRVEIFDVPGPVTELKPVVVNRKMALLNWSDPIDDGGSDITGFIIERKDA
KMHIWRQPIDTERSKCDITGLLEGQEYMFRVMCKNKFGCGPPVDLGPILAVDPQGPPGSP
ERFTYTERTKSSVTLDWKPPRNDGGSPIIGYIIEKRRHDATEFERCNKRLVPETSFLVDN
LAELHMYEFRAKAVNDIGESEPSLPLNVVIQDDEVPPTITLRLTVRGDTIKVKAGEPVNI
PAEITGLPMPKIEWSKNEVVIEKVPPSMKIAKQEVSRTDAKSEVIIPSAQRSDKGTYTIT
ASNRLGAINRSVNVEVYDRPSPPRNLQVTDIKAESCYLIWDAPLDNGGSEISNYIVDKRD
ASKKKSEWEEVSNIVVDRRYGIWKLTTDGEYQFRIRAVNKYGISDDCLSDKVVIKDPFGL
PGPPKKPKVTDHTRSSMLVSWEPPLDNGGSPITGYWLEKREVGGVYWGRVNRAPVTKPAV
KGLEFNVLRLIEGVEYQFKVMAINAAGVGPPSEPSDPALATDPIFAPGAPSCPDVKDKTK
NSVSLAWKKPDKDGGSPIKGYLVEMQEEGSSEWKKVNEPDKLFPTCDCVVPNLQELKKYR
FRVKAVNAAGESEPSLATGEIPVKEIQEEPDISIDLKAQDYLNCRAGSQIKISAVIKGRP
VPKTSWEFDGVAPKEIKDQVHNLPVDSQVEATDTTSVIIIPKCNRGHSGKYTITAKNKAG
QKTVNVRVNVLDAPGPPKDLKVGDVTRSTAKLTWKAPDNDGGDRIKNYIIEKKTVEAKSW
SKVANDCAGTSFTVPDLIDGQEYFFRVTAENRFGTGPPISTIQRTRARDPIHPPEPPTRL
KVGLVTKNSVALTWRPPKNDGGAPVTHYIIERLVWDPSGEGKETWKQCNKRDVEETKFIV
EDLKEGGEYEFRVRAVNEAGHSKPSSTVGPVAVKDQTCPPSIELKEFMEAEEGTDINILA
KIKGCPFPTLKWYKAPPNKPDDKTPVQYDQHVNKVVGENDCTLVIHQSHRRDTALYTLTA
ENNLGADSKEMRLNVLGRPGPPEGPIKFEAITAENMTLAWLPPKDDGGSKITNYIIEKRE
ANRKIWSPVTKEAKECIYTIPKLIEGHEYVFRIMAQNKYGVGLPLDSEPETARNLYSVPG
QCEKPSVSSVSRDSMTVNWEEPEYDGGSPVTGYWLELKETTGKRWKRANRDPIKIMTLGV
SYKVTGLIEGCDYQYRVMAINAAGVGPPSLPSDPATARDPISPPGPPFPKVTDWTKSTAD
LEWVPPSKDGGSPITGYFVEYKEEGKEEWEKAKDKEIRGTKFVVPGLKEGSFYRFRVRAV
NAAGVGEPGDVTDLIEAKDRTVLPDIQLDASVKERIVVHAGGVIRIIAYVSGKPAPEIIW
NRDEKALPQEATIETTAISSSLVIKKCQRSHQGMYTLVAKNAGGERRKTIIVDVLDVPGP
VSQPFQTENLTNDSCKLTWFSPEDDGGSTITNYIIEKREADRRGWTPVTYTVTRQNAVVQ
GLIEGVAYFFRIAPENIIGMGPFVETPREIVIKEPISVPERPEDLQVTAVTKDSISLSWN
PPKYNGGSDITMYILECRLIGKDKFLRATKEKLMGRKYDHEGLKEGDTYEYRVSACNIVG
QGKPSFCTKPITCKDELAPPTIELDFRDKLIVRVGEAFAMIGRYTGKPAPKVTWLKDEIT
VKEDDRTKIKTTKNTLCLGILKSVREDSGKYCVLVENSTGARKGLCEVTVVDRPQPPVGP
VIFDEVHKDHMVVSWKPPLDDGGSAITNYVVEKRDTNRDLWMPVTSATTKTTCKVPKLIE
GREYIIRICAENLYGISDPLLSDEMKAKDRFRVPEAPEQPLVKEITKDSALVLWNRPRDG
GKPIFAYIVEKKETMANRWSKVSREPIYPDTQFRVTDLLQGCEYEFRVSAQNEIGIGDPS
PPSKPVFANDPIVKPSPPVNPEAVDKTKNSVDLSWHPPRHDGGGKIIGYLVEYQKVGEEE
WKKSNHAPDSCPDTKHKVVGLTEGDTYKFRIKAVNSAGESEPADVRDPVQVKDRLEPPEL
IIDANMAREQLVKAGNTIALSAVIKGMPFPKVTWKKADKEIPTKADVVVTPVGSKLEIRN
CVKEDAGVYSLTVENEAGSKTVEVKVTVLDKPDPPRDLVVSEIRKDSCYLTWKEPEDNGG
SVITNYVVEKRDVANPRWIPISTTSKKHSIMARHLMEGTQYLFRVAAENQYGRSSYIETP
KPMKAIDPIYPPGPPKNLHHVDVDKTEVSLAWNYPDRDGGSEITGFVVDYQEDGAEDWIN
FKTVSIPECLVTGLKNGKVYKFRVRAQNIAGLGRPDTTVPIECQEKLAAPTIEVDVKLIE
GLVVKAGTTVRLPAIIRGIPIPTAKWVTDSAEIKSEGSYKIDTDSFSTVLTIKDCTRKDT
GEYLLTVSNVAGSKTVALHLTVLDVPGPPTGPLNILEVTPEYMVISWRPPKDDGGSAVMN
YIVEKCEGKKETWGIVSSGSTQTKAKIPRLQKGYEYTFRVSAENKMGIGKPLESKPTVAK
HIFDPPSPPGKPVVSDITENSATVSWTIPKSDGGSPISGYIVERRELSGKWVRVNKTPVL
DLRFRATGLYEGNTYEFRVFAENIAGLSKPSPVSDPIKASRPITPPGPPINPKLKDKSRE
TADLVWTKPTRDGGSPILGYVVECQKSGTAQWNRINTDDLIKQCAFRVPGLIEGNEYRFR
IKAANIVGEGEPRELPESVIAKDILHPPEVDLDLTCRDLLTVRVGQTINITARVKGRPDP
DITWSKDSKVVTKDNRTEMTQDFPPVGLQIKPATRADHGKYTLVAKNSSGQAQGVVIVNV
LDRPGPCQNLKISYVTKDSCMVAWENPQDNGGSEITNYIVEYREPSKRGWYVISSDLTKR
LIKASLIEHHEYFFRVCAENKVGPGPVTETKTPILAINPVDKPGEPENLHIAEVGKTFVF
LKWRRPDYDGGSPNLSYHVERKLKDSDEWERVHKGSIKETSYLIDRCSENQLYQFRVQTK
NEGGESNWVKTAEVLVKEELLKPALDLKLTGMLVVKAGETIRIEAGVRGKPQPEIAWAKD
KDTTDIAKSPRLKIENGSDYTKFILEKSRRSDSGKFVVTATNPAGSFTAHASVNVLDVPG
EVRNLKVSDVSIDRCRLSWDEPEDDGGCEIQNYILEKCESKRMVWSTYSASVILTHAQVT
RLIEGNEYIFRVRAENKLGTGPPTETKPIVAKTKYNRPGPPEPPEVTKVSKEEMTVVWNP
PEYDGGKSITGYILEKKEKRSMRWVAATKSAIPERRLKVPNLIPGHEYQFRVKAENEIGL
GDPSGPSRPVVAKDPIEPPGPPSNLKVADSTRTSITLGWGKPVYDGGAPIIGYVVEMRPK
TEVKDKDPEAGWKRLNVAAQLIHTQFTVTTLDEKQEYEFRVSAQNQVGIGRPAELKEAVS
PKEILESPEIELDASMRKLVTVRAGCPIRLFAMVRGRPSPKVTWRRMGIDNVVRKGQVDI
LDTMAFLVIQNSTRDDSGKYSLSLVNVAGEKAVFVNVRVLDTPGPVAEFTVSDITKMSCQ
LSWVPPENDGGSPVTHYILERREVDRKTWAKVVADWKKTSFKVANLVPGTEYFFRVTAIN
EYGSGVPRDTPKGVLATDPISEPDPPKKLDVTEITKNSATLAWLPPLRDGGAKIDGYIIS
YQAEGQSQDNWTQYSVVKDLNIVVVGLKEGTKYKFRVAARNSVGVSLPREAEGIFEIKEQ
LLPPKILMPDQISIKAGQKLRIEAHVYGKPAPVFKWMKADVDVMPSSRLAVHKGKNSTVL
IIKDVTRKDSGYYSLSAENSSGVASHRIRVVVMDIPGPPEPPFEISDIDSDACTLSWHLP
LEDGGSNITNYVVEKCDVSKGDWITAVTSVTKTSCRVGKLIPGQEFIFRVRAENRFGVSE
PITSNRVVAKYPFDVPSEPKNAHVTKVNKDCIFVAWDRPDNDGGSPITGYAIERKERNSL
LWVKANDTAVRSTEYPCVGMIEGLEYTFRISALNRAGSSKPSKPTEYVTARTPVDPPGKP
EVIDITRSTVSLVWTRPKHDGGSKIVGYLVEACKLPGEKWVKCNTAASQVPTEEFIVTEL
EENERYQFRAIAKTSINISRPSEPSDPVVIQAENVPPKIDLSIQMKSLITVKAGANVCLD
AQVFGKPMPTVAWMKDGEVVKPAEGVKISSKRNLFLLELFSVNRKETGEYTIVAENASGS
KSATIKLKVLDKPGPPASVKINHMYTDRAMLSWEPPLEDGGSDITNYVIDKRETSRPNWA
QVTANVQTTSCSVEKLIEGHEYQFRICAENKYGVGDPILTESVIAKNPYDAPGQCDPPVI
SNITKDHMTVSWKAPADDGGSPITGYLLEKRDTKSFNWTKVTKTPVMDRTVKATGLQEGT
EYEYRVTALNKAGPGKPSNSSRAVIAMDPQYPPGPPAFPKVVDTTRSSISLSWSKPAYDG
GSPIIGYLVEVKRGDTDNWVRCNLPKNLHDTRYTVTGLMESTEYQFRVSAVNKIGYSDPS
EIPEKHTAKDILIAPEGELDAELRKALVLRAGVTMRIYVPVRGRPAPKISWSKLNANIKE
RQGLDIKTTDHDTFLRCENVNKYDAGKYILTLENSSGVKSYTIVVKVLDTPGPPVNLIIK
DSSKDSAMISWDPPIIDGGSPIKNYIVEKRDAERKAWSTVSTDCPKTSFRITNLEEGKAY
FFRVLAENEYGIGEPCETHDAVKASEKPGPVIDLKALAVSKSSCTIAWKKPISDGGSRII
GYVVEHLISQDKWKDIMRSKNLQYTMKDLTEGKEYTFRVIAQNDSGFSSPTDISIVAKDD
VVAPNVDLKDLPDLCYIAKEGSTFRLKIPVSGKPAPTITWRKSEDKVLTDSGRVTVESTA
VNTTLTVRECQKDDASKYTITLKNPAGTKESTIFIKVVGKPGIPTGPVKFDEVTADAITL
IWAPPKDDGGSEITNYILEKRDSVTNKWVTCASAVQKTSFRVTRLHEGTEYIFKVSAENK
YGVGDGLKSDSVVARHPFDVPDAPPPPKIVTIRHDAANLTWVDPRKTGGSPITGYYIEVK
ERNSLLWKRASTTPLRMKDYRVTGLAEGLEYEFRVMALNLAGVGKPSLPSESVVALDPID
PPGKPEVISVTRSSATLIWTEPKYDGGHKLVGYIVEKRDIPAKSWMKANHVNVQECAFTI
NDLIEGGKYEFRIRAKNTAGAISPPSETTGTVVCKEEYEAPTIVIDAAVKEGLTVKAGDT
IVMTATRILGKPPPTSVWSKAGKDFKPSDIVQIETGPTSSTLSVKYASRKDSGEYTITAS
NPFGTKEEHVHVKVLDVPGPPGPIEASNVSAEKATLNWTQPAEDGGSPITSYTLEKRETS
RLLWTLVAENIQSCRHVVSKLIQGNEYIFRVSAVNHFGVGEPVQSEPVKMVDRFGPPGPP
GKPEVTNVTKDTITIAWKRPADDGGSEITGYFVERKEKKGLRWVRASKKPVSDLRLKVTG
LAEGNEYEFRVSAENKAGLGPPSDSSLPALTKDIAYPPGPPSNPKVIDTTKSTATLHWGK
PHYDGGLDITGYIVEHQKEGEEEWVKDTTGTALRITEFVVANLQPGAKYKFRIRAINAAG
TGEPAQIDDVEIKDREETPDFELDAELRRTLVVRAGLSIRIFVPIKGRPTPEVTWMKGDV
PLKIRANIENTESYSLLILTECNRYDAGKYTMTLENAAGKKSGFVNVKVLDSPGPPLNLK
ARDVTKDSITLQWDMPLIDGGSRITNYIVEKRESTRKAYSTITTNCQKCSLRIPNLAEGC
EYYFRVLAENEFGIGEPAETADPIRATEAPSPPESLNIMDITKNSVSLAWPKPEHDGGSK
ITGYVIEAQRKGSDQWTHIAIVKTLDYLVKNLNENEEYVFQVMAVNSAGRSDPRESRPVI
VREQQMLPEFDLRGIYQKTVLARAGDNIKVEIPVLGRPKPTVTWKKGDQLLKETQRVNVE
RTATATILNINECTRTDAGKYTLAAKNIVGEISDVITVQVHDIPGIPTGPTKFDEISSDF
ITLSWDPPENDGGVPISNYIVEMRETNSTSWTELASTVIRTTFKATKLTTGLEYQFRVKA
QNRYGTGPALNSEAVVAAYPFRVPGPPGTPQVIAVTKDSMTISWNEPVADGGSPILGYHI
ERKERNSILWQTISKTLFLGNIYKSSGLTDGIAYEFRTVAENMAGKSKPSKSSEPTFALD
PIDPPGKPVALNITRHSVTLQWTKPEYNGGFKITGYTVEKRDLPNGRWLKANFGNILETE
FTVSGLTENTEYEFRIIARNAAGAVSQPSEPSDAITCRDDIEEPRIMVDAKFKDVIILKA
GEIFRLDADVSGRPIPLLTWTKEGKDLEDTSKLELKIADFSTALINKDSARKDGGAYTLT
ASNPGGFAKHVFNVKVLDRPGPCEGPLAVSEVTSEKCVLSWLPPLDDGGAKIDHYIVEKR
ETSRLAWTNVAPDIQVTKFKVTKLLKGNEYIFRVMAVNKYGVGEILESVPTLAVNPYVPP
DPPKTPEVTTITKDSMIVCWGHPDSDGGSPITNYVVERRDKAGLRWVKCNKRILTDLRYK
ASGLTEGHEYEFRAVAENAAGISKPSQCSPYYKACDTVFKPGPPGNPRVLDTSRSSITIA
WNKPVYDGGSEITGYNVEISLPEEDEWKVVTPPAGLKATSFTITGLKENQEYKIQIYALN
SEGAGESALVPGSPKAEDRMLPPEIELDAELRKVISIRACCTLRLFVPIKGRPAPEVKWN
RENGEHIERASIESTSSYTLLVVENVNRFDSGKYMLTVENSSGSKSAFVNVRVLDTPGAP
QDLKIKEITKSSVTLTWEPPLIDGGSKIKNYIVEKRESTRKAYSTVTANCHKTSWKIDAL
QEGCNYYFRVLAENEYGIGLPVETSDSVKVSERPLPPGKISLDDVTRNSISLSWEKPEHD
GGSRIMGYIVEMQSKGSEKWTTCATVKTTETKITGLIQGEEYMFRVSAQNEKGISDPRQL
GVPVVAKDLVIAPAVKLQFNTFSVLAGEDLKVEVPFVARPKPTVAWHKDSLPLKQTTRVN
AEHTGSISLLTIKEASKEDVGQYTVKLANTAGEASEQLRIIVLDKPEPPTGPVKIDEVTA
DNISISWEPPKYDGGSSINNYIVEKRDTSTTVWQIVSATVARTTIKATRLKTGSEYQFRI
AAENRYGKSGYLVSAAVVAQYPYKLPGPPGTPFVTSVSKDSMVVQWNEPVNDGGSKILGY
HVESKERNSILWVKMNKTILPDTKIKTTNVEEGIEYEFRVYAENIVGIGKPSKISECYVA
RDPCDPPGRPEALVVTRNSVTIQWTKPEYDGGSKITGYIIEKKELPEGRWMKASFTNVIE
TLFAVTGLVEDQIYEFRVIARNAAGIFSEPSESTGPITARDEVEPPRVSMDPKYKELITI
NAGEMFKIEADVHGKPIPSVQWFKAGEELVNTARLEIKGTDFFTSLSVKEAIRVDSGQYI
LLLKNVGGEKSVSVNVKVLDRPGPPEGPITISGVTAEKCSLAWKPPKQDGGSDIDHYVVE
RRETSRLVWTVVDSNVQTLSCKVTKFLEGNEYIFRIMAVNKYGVGEPLESEPVLAKNPYV
VPQAPKAPEVTAITKDSMVVVWERPAFDGGSEIVGYVVEKRDKEGIRWVRCNKRLVSELR
FRVTGLAESHLYEFRVSAENAAGLSEPSQPSIYYKAFDPIYKPGPPNNPKTVDVTRSSVF
LSWGKPIYDGGCEIQGYIVEKFDISTDEWSMCTPATGIKETRLEVDRLLAKHEYKFRICA
VNKAGVGEHADVPASVIVEEKLEIPDLDLDLELRKVVNVRAGGSLRLFIPIRGRPTPEVK
WAKVDGEIRETAQIDVTSSFTTLVLDNVNRYDSGKYTLTLENSSGTKSAFISVRVLDTPS
APVNLKIKDITKESVSLTWEPPALDGGAKIKNYIIEKRETTRKAYAAVATNCHKTSWKID
QLQEGCSYYFRVTAENEYGIGVPAETPEPVKVSEVPQPPGKITVIDVTRNSVSLSWEKPE
HDGGSKIIQYIVEMQAKGSEKWSDCARVKTLEAVITNLTQGGEYLFRVVAVNEKGKSDPR
SLAVPVVAKDLVIEPDVRPAFSNYSVQVGQDLKIEVPVAGRPKPTIAWTKDGQALKQTTR
VNVTDTANMTVLNIKETSKDDAGMYAITVSNVVGQKVASIELITLDKPDPPSGPVKFDEV
TAGSVTLSWNPPGYTGGCQITNYIVEKRDTTTTVWETVSATIARTTLKVSKLKTGTEYQF
KIFAENRYGRSFGLESEAVVAQYPYKEPGPPGTPSAAAITKDSIVVQWHEPINDGGSRVI
GYHLERKERNSIMWTKVNKTIISDTYFKTSNLDEGIEYEFRVYAENIVGIGKSSKVSECY
CARDPCDPPGCPEAIIVTRNAITLSWKKPEYDGGSMITGYIVEKRDLPEGRWMKASFTNV
IETQFTVTGLTEDERYDFRVIARNAAGSFSKPSDSTGPITAKDEVEPPRISMDPKYKDTI
VVNAGDTFKLDADVHGKPIPTIQWFKGEKEVEDSARCEVKNTDFKALIVVKDAIRVDGGQ
YILQASNVAGTKSVPIQVKVLDRPGPPEGPVHVTGVTVDKCSLAWAPPQHDGGSDISHYV
IEKRETSRLAWTVVASEVVTTSLKVTKLLEGNEYIFRIMAINKYGVGEPLETAPVLMKNP
FVLPGSPKSLEVTNIVKDSMTVCWSRPDNDGGSEIIGYIVEKRDRAGIRWTKCNKRRITD
LRLRVTGLTEDHEYEFRVSAENAAGVGEPSQLTAYFKACDPIFKPGPPSNPHVVDTSKNS
ISVVWGKPIYDGGSEIQGYILEICKGDEEEWSMVTPQTGLQVTKYEIAKLIEHQQYQIRI
CAINKAGVGEAASVPGTVKPEDKLEAPEIDLDSELRKGILVRAGGNVRIQIPFSGRPVPE
ISWSKEDGELSEKAQIERGFNYTQFSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDT
PGAPINLLVKDIKKDSVILTWEPPLIDGGAKIKNYVIDKRESTRKAFANVTAKCNKTTYK
VENLTEGAVYYFRVMAENEYGIGLPVETVDAVKASEAPLPPGKITLTDVTQRSVSLIWEK
PEHDGGSRIIGYLVESQPKGVEKWSIAAETKTCSAVVSGLSPGQEYSFRVLAYNEKGKSD
PRVLGLPVIAKDLTIEPSFKLMFNSYNVQAGEDLKIDIPIIGRPRPTITWAKDGQTMKQT
TRVNVEDTAVSTVLHIKESNKDDFGKYTVTATNSAGTATENISIIVLDKPGPPKGPVRFD
EISSNYVVFSWDAPEYTGGCQINNYIVEKRDTTTTTWQTVSATVARTTIKVTKLTTGSEY
QFRIYAENRYGKSSPLDSTAVVVQYPYKEPGPPGTPFVTSASKDHMVVQWNEPVNDGGSK
VLGYHVERKEKNSILWAKLNKTLLQDTKLKTNGLEEGLEYEFRVFAENIVGIGKPSKVSE
CYVARDPCDPPGRPEAIEITRNYVTLHWRKPEYDGGSKITGYIVEKKELPDGRWMKASFT
NVLETEFTATGLTEDDRYEFRVIARNAAGNFSEPSESTGPITARDEIDAPRASLDPKYKD
VIVVNAGDTFILEADIHGKPIPDVTWSKDGKEIETTTARSEIKSTLQRTTLTVKDCVRVD
GGQYVLNLSNVGGTKPIPITVKVLDRPGPPEGPLKVTGVTSEKCYLAWGPPSQDGGANIS
HYNIEKRETSRLSWTQVASEVQALSHKVTKLLAGNEYIFRVVAVNKYGIGEPLESEPVLA
RNPFKPPSAPTTPEVSAITKDSMVVTWGRPQDNGGAEIDGYILEKRDKDGVRWTKCNKKR
LTDLRLRATGLTDGHFYEFRVSAENAAGVGEPSEPSIFYRACDAIYPPGPPGNPKVTDTS
RSSVSLAWSKPVYDGGAPVSGYIVEFKEAAADEWTTATPPTGLQGKQFTVTKLKENAEYS
FRVCAINSEGVGEPATLPGTVIAADKLEPPEIELDADLRKTVTVRAGGSLRLFVTIKGRP
EPEVKWEKAEDKLTERAQIEVTSSYTMLVIDNVNRFDSGRYNLTLENNSGSKSAFVNVRV
LDSPSAPVNLTVKEIKKDSVTLSWEPPLIDGGSKITNYIVDKREATRKAYATVTNNCTKN
TFKIDQLQEGGVYYFRVLAANEHGIGLPSSTTDPIKVSEAPLPPGRVTLVDVTRNSATLS
WEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATITGLSSGEEYTFRVIAVNEKG
RSDPRQLGVPVIAKDIEIQPTIELLFNTFSVKAGGDLKIEVPVRGRPIPDITWKKDGQAL
KQTTRVNVQITKTSTLLSIKEGTKDDVGQYELTASNSAGSVTASLGVIVLDKPGSPGPIK
IDDVSADNISFSWSAPEYDGGCHINNYIVEKRDTTTTVWELVSATVARTSIKVGRLTTGS
EYQFRVCAENRYGKSHYTDSPSVVAQYPFKPPGPPGTPRVAHSTKAFMIVSWQPPVNDGG
SQVTGYHLEKKERSSILWAKVNKSLISDTQLKVTGLEEGLMYEYRVYAENIAGIGKCSKS
CEPVPARDPCDPPGQPEVTNITRTSVSLAWKKPEYDGGAKITGYIIERKELPDGRWLKCN
FTNVQDTFFDVTALTEDQRYEFRVIAKNAAGLFSEPSESTGPITVKDDVDAPRIMMDVKF
RDVVVVKAGEILKINADIAGRPHPVVSWTKDGKEIEEKARIEITSTDNSTVLVVKDCIRR
DSGQYVLTLQNVAGTRSLAVNCKVLDRPGPPVGPLQIAGVTAEKCSLSWGPPQENGGAEI
DYYVVEKRETSRIAWTVSESELRTTSCKVTKLLKGNEYVFRVMGVNKYGVGESLESEAIK
ALDPFTIPSAPKSLEITSVTKEAMTICWARPESDGGSEIAGYVIERREKNSLRWMRVNKK
PVYDLRVKSSGLRQGCEYEYRVYAENAAGLSAPSECSPLIRAEDPIFLPSPPSKPKIVDS
TRSSVTISWVKPLFDGGSPVTGYTVEYKKSDDTEWTTSITNVRGTEYAVVALTSGAEYSF
RVRSVNKVGPSEPSESTEPQIVKDREEEPAFDIDTEMRKTLIVKAGGSFTMTVPYRGKPV
PNVMWSKPDSDLRTRATIDTTDTRTSLSIEKATRNDSGKYTLTLQNVLNTATLTLVVKVL
DSPGPPSNIVVKEVTKESAVLSWDVPENDGGAPVKNYYIEKREASKKAWVSVTNNCHRLT
YKVTGLQESGVYYFRISGENEFGVGVPAETKEGVKITERPSLPEKLGVTNVTKDSLSLAW
SKPEHDGGSKILGYLVEALEKGQQKWVKCAVVKTTHLDIRGLKENVDYFFRVFAENQAGL
SDPKELLLPVTVKEKLESPEIDMRGYPSNTVYVRAGSNLKVDIPVSGRPLPKVTLSRNGL
LVKSTLRFNTETTAESIIINLKESVASDAGSYELTASNSSGTTKATLKIVVLDRPGPPLG
PVVISDVSEDSVTLQWEPPGYDGGSQVTNYIVLKRETSTAAWSEVSSTVARNVTKVMKLT
KGEEYQFRIKAENRFGISDHIDSECVTVKLPYTIPGPPSTPWVNNVTRESITVGWHEPVS
NGGNSVIGYHLEMKDRNSILWQKASKTIIRTSHFKVNNISAGLIYEFRVYAENAAGIGKA
SHPSEPVLAIDACESPRNVRVTDITKVSVNLAWQKPAYDGGSKITGYMVEKRDLPNGRWT
KASFTNVIETQFNVSGLTQGNQYEFRVFAKNAVGSISNPSDVAGPITCVDTYGAPQIDIP
PEYTDVVKFKAGVAVKLKLGISGKPFPAIEWFKNGKEIQTSAQVSIESTSEFSSVLIKDA
SRVNTGLYELKLKNAMGSASASIRVQMLDKPGPPAGLIQFKTVTAEKMTFSWEPPADDGG
SKVTHYIVEKRETSRIVWSLVSEKHEVCMITITKLIKGNEYIFRVRGVNKYGVGDPLESE
PVIARNAFVTPGPPSIPEAATITKNSMTVTWSRPTVDGGSDISGYYLEKRDKKSLRWFKV
IKESIRDTRQKVSGLTEDSEYQYRVCAINAAGQGPFSDASDYYKAADPIDKPGQPTKLKI
VDSTKSSITLSWSKPVYDGGSPITSYVVEVREGESEEWTVVSAKGEVRTTEYVVSLLKPG
VDYYFRVCAVNAAGKGEPIEMTEHTQAKDILEEPEIDLDVALRTSIVAKRGEDVQLMIPF
KGKPTPTVTWRKGEKNIGNDPRYNIQNTESSTLVDIPQVTRHDTGKYVLTIENGVGQPKS
TFVTVKVLDTPAECQKLQIKNVARGTVTLVWEPPLINGGAEVTNYVIEKRDATKRAWAAV
TTKCSHTSFKITNLSEKTAYFFRVLAENENGIGEPCETTEPVKASEIPGPIRDLTMKDST
KTSVTLAWSKPDYDGGSLVSEYVVESKLKDDKEWSNAGISKACEFEVSKLKELSVMEFQV
SAKNEKGLSDGVILGPITVKDYVITPVADISEILGGQITVRIGHNVHIEIPYKGKPRPTI
SWLKDSIPLKESEQVRFKKTEAKLSLSIKNVKKENGGKYTLILDNGVARKSYVITVIALG
PPSKPKGPIRFDEIRADSVIISWDVPDDDGGGEITSYSIEKRETSQTNWKMVCSSVARTT
FKIPNLVKGIEYQFRVRAENRYGVSLPLNSSDVIAKHQFRPPGPPGKPVVYNVTSDGMSI
TWDAPVYDGGSEITGFHVEKKERNSILWQRVNTTPLSNREYRITGLIEGLDYQFRVLAEN
TAGLSPVSEPSKFTLAVSPVDPPGTPDYIDVTRETVTLKWAPPQRDGGSKIVAYSIERRQ
GNERWLRCNFTDVSECQYTVTGLSPGDRFEFRIIARNAVGTVSPPSQSSGYIMTRDESIA
PTIEFGPEHFEGLTVKAGEIIRAKALIKGRPLPQVVWLKDGKEIEKKLGVEINTAIGYSS
IFVRDATRDHRGVYTVEAKNSSGTRKADMTIRVQDTPGPVGGPIRFSNINGEKLTLWWVP
PANDGCAVITQYVIEKRETSRLSWAQVTDQCEACSYTVTKLIKGNEYQFRISAANKFGVG
KPLDSDPVIAQIQYTVPDAPGVPDATHVTGDSITVTWARPKSDGGNEINHYILERREKKS
LRWVKVSSKKPITETRYRVTGLVEGNEYEFRAIAENKAGVSEPSAVSRLIKCKEPVNPPS
APSVVKVSDTTKTSVSLEWTKPAFDGGMEIIGYIIEMCKADLGEWHKVNAEAIVATKYTV
VDLEAGENYKFRVSAVNGVGKGDSCEVPATVQTTDRLTSPEIDIDANFKQTHIVRAGASI
RLFIAFKGRPSPTAIWTKSDSDLSVRADIHTTDSFSTLTVEDCNRYDAGKYTFTVENNSG
TKSITFTVKVLDSPGPPGPITFKDVTRGSITLLWDASLNDGGARIHHYVVERREASRRSW
QVVSEKCTRQIIKVSDLLEGQPYYFRVSAENEYGVGEPFETPEPIVATEEPAPPKRLDIV
DTSKSSVTLAWLKPEHDGGSRISSYLIEMKQKGSDHWIEAGQTKLLTLIVGNLTENTEYE
FRIRAKNDAGYSEPREAFSSVIIKEPQIEPTADLSGITRQLITCKAGSNFTIDIPISGRP
VPKVIWKLEEMRLKETDRVNIKTTKDRTTLSVKDSMRGDSGKYYLTLENTAGIKTFTVTV
MVIGRPGAVTGPVEVSSVSAESCVLTWAEPEDNGGTEITNYIVEKRESGTTAWQLVNSSV
KRTQIKVTHLTKYMEYTFRVSAENRFGVSKPFESTPIIAEHPFVPPSPPTRPEVFSVSAN
AIGIKWEEPYHDGGSKVTGYWIEKKERNTILWVKENKISCFDSNYKVTSLVEGLEYQFRV
YALNAAGISKASEASRPVMAQNPVDPPGKLEVTDVTRSSVSLSWTAPLYDGGSKVVGYIV
ERKPFNETGDGRWLKCNYTTISENVFTVTALSEEEVYEFRVLAKNASGVISAPSVSTGAV
TCKDEYSPPKAELDSKLQGDVVTVRAGSDLVLDASIGGKPEPKVFWSKGDKELDLCEKIN
LQYTSKRALAIVKFCDRSDTGKYTLTVKNASGTKSISVLVKVLDSPGECAGKITISRVTD
EKCTLAWNPPQEDGGAEITNYIVERRETSRLHWVIVEPECLTLSCNVTRLIKNNEYIFRI
RAVNKYGPGVPLESEPVIARNSFTIPSPPGAPEAIGVGKEHVIIQWLKPESDGGSEISTY
IVDKREKKSVRWTRVNKDYTIYDTRLKVTNLLEGSEYQFRVSAVNAAGNSEPSDSAPYVL
CKDPSYTPAAPSVPRVVDTTKSSISLAWSKPLYDGGADILGYILEVQEDGTEQWYRPHTT
TLLRNPEFTLTGMKTSHKYKFRVAASNANGTSDFSESSAEIEPVERIESPDLELADDLKK
IVTIRAGGSLRLMVSVSGRPSPVITWRKEGVDLASRAMIDITDSYTLLVVEKVNRHDAGK
YVIEAVNQSGKKSATVVVKVYDSPGPCGAVKVKEVSKDSVTITWDVPVLDGGAPVNNYII
ERREAAMRAFKTVTTKCNKTIYRITGLQEGLMYYFRVLPENIYGIGEPCETSDAILVSEV
PMIPQKLEVVDITKSTVALKWEKPLHDGGSRLTGYVIEACRAGTEKWMKVATLKPTVLDF
TITSLNDGEEYLFRVRAQNQKGVSEPREIVTGVTVQDQKVLPSIDLTGITQKTVHIPSGR
PIELALPIHGRPPPAVAWFYAGSRIKEVDRVKIETVNKVAKLTIRETTINDTGDYTLEIK
NTSGTVTETIKVIILDKPGPPVGPIVIDDIDATSVSISWESPLMDGGATISGYVVEQRDA
HRPGWLPVSESVTRTMFKFTRLTEGTEYVFRVAATNRFGIGSFLQSEVVECKSRISIPGP
PETPQVFDVSRDGMTITWNPPDEDGGSQIVGYIVERKEVRADRWVRANKVPVTMTRYRST
GLIEGLEYEHRVTAINARGVGKPSRSSKSAVAMDPIDPPAKPQNPRVTDTTRTSVSLAWS
PPEEEGGSKVTGYLIEMQKVDQYEWTKCNTTPTKICEYTLTHLPQGAEYRFRVLACNAGG
PGEPADVPGTVKITEMLEYPDYELDQKYQEGLVVRQGSAIRITIPIKGKPIPVCRWTKEG
RDVSKRAMIATSDTHTELVIKDAVREDSGTYDLLLENKCGKKAVYIKVKVIGSPDTPVGP
LEYDDIQARSVRVSWRAPADDGGSDILGYIVERREVPKAAWYTVDSRVKGTSLVVKGLKE
NVEYHFRVSSENQFGISRPLKSEEPAVPKTPLNVPEPPSNAPEIVDVTKSSVSLSWSRPR
DDGGSRVTGYYIDRKETTTDKWVRHNKTHITTTMYTITGLVPDADYQFRIIAQNDIGLSE
PSPASDSVVCKDPFDKPSQPGEIEVTSVSKDSITIQWEKPECDGGKEIFGYWVEYRQSGD
SAWKKCNKERIKDRQFTMGGLLEATEYEFRVFAENETGISRPRRTAMTVKTKLTSGEAPG
LRQEIKEVTTKLGESAKLSCQIVGRPLPDIKWFRFGKELVQSRKYKMSSDGRNHTLTVLT
EEQEDEGLYTCVAVNDAGEIETSGKLLLEAVPQFHPGFPLKEKYYSGVGTTLRLHVAYIG
RPVPAITWFYGKKPLKSSENITIENTEHYTHLAIKNVQHKTHAGKYKVQLSNTFGTVDTV
LNVEIQDKPDKPTGPIVVDALLKNSVVISWKPPVDDGGSMVTNYVVERREAKEGEEWHLV
SSSISGTTCRIVNLNENAGYYFRVSAQNLYGISDSLEIPSIVLIKSPFEKPGQPAKPVST
AVTKDSCVVSWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIHETVYSVKGLIEDLE
YEFRVKCENLGGESEWSETSDPIVPKSDVPVRAPQFKEELRNLNVKYRSTATFVCKVVGH
PKPVVKWFKQGKEILPDGEKVKVQEFKGGYYQLVITNVFEDDSTVYQVRATNQGGSISST
ASLDVEVPAKIHLPKHLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGQY
QVIVTRSFTSLVFSNGVDRKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGLKVSEVS
RDSVNLTWTAPATDGGSKIINYIIEKCATTAERWIRVGQSRETRYTVVNLFGKTRYQFRI
IAENKFGQSKPSEPTDPVVTKEDKSRMLNYDDEVSEIEISKTKAEHSSTKVLHERFSIAE
ELGHGQFGIVHRCIHSASKKTFLAKFVKVKGADQVAVKKEISVLNVARHTNLLYLYESFE
SLEELVMIFEFISGVDIFERIGAAGFDLCEREIISYVRQISEALEFLHSKSIGHFDIRPE
NILYTTRRSSRIKITEFGQARQLIPGDSFRIQFTAPEYYAPEVHQHDLVSTATDMWSLGT
LVYILLSGLNPFAAETNQLIIENITHAEYNFEDEAFKDVSLEALDFIDRLLVKERKSRMT
AAEALEHSWLKQKSEKQSTKVIKTLRQRRYYQSLIKKEWNFVVSVARISCGGAIRAQKGV
TVAKVKVASIEIGPISGQITHAVGEEAGYAKFSCKIENYDQSTQVTWYFGIRQLENSDKY
EITYNEGLATIYIKDIRKSDDGTYRCKVVNDYGEDSSYGELFVIGVREQSDYYRCRTVKK
VKRRADTMRLLERPPEFTLPLFHRTAYIGENIRFGVTITVHPDPQVTWLKSGQKIKPGED
EKKYTFESDKGLYQLIIHKLTTDDDAEYTVVAKNRFGEDSCKAKLTVIPHPAAADNTLRP
MFKRLLANAECQEGHSVRFEIRVSGTPKPILKWEKDGQALALGPNTEIIHEGLDYYALVI
RDTLPEDTGYYRVTATNSAGSTSCQAYLKVERMRYVKHEYKSEEERKVHVQRQIDKTLRM
AEILAGTDSVPLTPVAQQALREAAILYRPAVSTKTVKGEYDIQKEEKKKEVKVIRMPYEI
PEPRVHGATALEEDQSIKKFVPMSEMKWYRRLRDQYEMPEPLERIVQKRPKRIRLSRWEQ
FYVMPLPRITDQYKPKWRIPKVSQDDLETVRPARRRTPSPDYELYYRPRRRSLGDVSDDE
LLLSVDDYLAMKRVEEERLRLEEELVLGFSASPPSRSPPRFELSTLRYTSPEARVSREKR
TEAKCRYSAYHIPTKEEVTTSYADLRERYERAVYKPPKQKQRIIEEREEEELLRPYSTSQ
RLSQYTRDLEYMEKEEKSRLLSRREREITEITDVEEAQEEVTRRVSRQIRQASPEVSRLL
GRRRSLSPTYIELMRPVSELIRSRSKPAEPQRRSPTPERTRPRSPSPVSSDRSLSRFERT
ARFDIMSRYESMKAALKTQKSSERKYEVLTQQPFTLDNAPRITLRMRSHRVPVGRNTRFI
LNVQSKPTGDVKWYHNGVEIQESSKYHISNVSGVLTLEIIDCYSEDSGTYRAVCTNYKGE
ASDYATLDVSGDDFSTYTPKRKDDAVPKSAFPELLKSEDYAFASFKKTSEFEASSSRREV
KSQVTSLRESSESYEAYASEEKRVSASEAKALEERVVHRKFKSSEPAKILTKPQSVTVSE
GESVRFSCDFDGEPTPTVTWQLAGKAIVSSTRHHITSTKYSSIFEITSVKLSDEGNYTVV
VENSEGKQEAHFTLTIKRSKAVEKGVTSPSRVKSPEPHKKSHDSIKSPKRVKSPEPTTPK
TKSTTKSPADKVQLPAVSAPKIAQNLKAVASDDKAKLKCMVESTLFNGREVSWYKNGKKL
REDGHFSFHYSSDGNYELTIHSISEADQGEYICEITGEGGVSKTSLQFVGQTFKSVFSQI
TTARESKKSVQVSKSVVHEEVGKTDLVSEGIKTLHTEIKSSVSSVSFSEGQKVTLKASMS
GASQIKWVLNGYELKNTEDYRYGVSGSDQTLTIKTISNKDQGILTCEGRTDQGIIKCQFD
LTSSKDASNAPSFVYQPKSQNANEGQNVVFTCEVTGNPSPEVEWFKDNILISVSSHIRVS
RSKNVYTLEIQNTTEKDSGKYTIKAKNYQGQCSATASLNVFRLVEEPSKEIVLKTAGEAN
LLEAFSLQSMQMSASKQEASFSSSSISESKFASVSSVKEASFMEMHSSSMMESSSLRHLE
SSSSRMLSAGFRGSSPKIEALPSDVSIDAGKVLTVACAFSGEPTPDIAWTQSGKSVPTDA
QKGRVHIETTEDLTTLTITDVQKRDGGRYTLNLSNDFGSDSASVNINVRTP
NT seq 104376 nt NT seq  +upstreamnt  +downstreamnt
atggctttacaagcaccgacgtttatacagcctttacaaagtgttgtggtactggagggt
agtgccgcaacctttgaggctcagattagtggttttccagttcctgaggtgagctggttt
agggatggccaggctatttccgctgcaacactgtccggcgtgcagatctcgtttagcgat
ggccgcgctaaacttgtaatccccgccgttacaactgcaaacagtggaagatattcccta
agagccgccaatggagcaggacaagcaactagcactgctgagcttcttgttactgctgaa
acagcacccccaaactttacacaaagactacagactacgacagtaagacaaggcagtcaa
gttcgccttgacgttagagtgagtggaatccctacacctgtagtgaagttctacagagag
ggagctgaaattcacagctccctagacttccagatccttcaagatggagacctctacagt
ttaataattgcagaagcataccctgaagactcgggaacttattctgtaaatgcaaccaat
aatgtcggacgtgctacttcaacagctgaactcactgttcaagctgaagaagaaatacct
gccaaaaagacaaagacaattgtatcgactgctcagatttcgcaaacaagacaagcacgt
ttcgaaaagagagtagaggctcattttgatgcaagatccagtaccacagttgagatgact
attgaagggcaactgccccacaaaactcctccaagaattcctccaaagccttcatcaaag
tctccaactccgccagtgattcctactaaggttcagatggtcaggcagcagtcaccatca
cctatacggcattctgcttctcctgtcagacatgtgaaagccccaattccttcacctgtc
aggtcagtctctccggctggaagaggactgtccacttctccaattagatctgtgaaatct
ccatctcctgcaaggagtgcactaacactggctggtgctgaggttccacctccttggaag
catgaagtatttgtgtcctcttcaacttcacagatgaagactgagcagaagtgggaagca
agggagcaggtgactgtcactggagtagagcagagagaggtctacggaccagggaaaaca
gtagctgttgctacagtagttgctgctgttgacctggccagagtgagagagcctgctcca
agtaccattgaagtgactgctaaaaggacagcaatgtctgccgtgcaaattcagcctgtc
catgaacaggtaagaaaagaagctgaaaaacctgtaagcactgtagttgtgtccactgac
aaacgcaaacaagaaacggttacaagaactgtagaaggagttgcagccaagcgtgaacaa
atacacgcagtacaagaacagatgaattacaattctgaggtaggaatggcggtggctaca
gttctggctgctgtggagcaagcaaggaaacggactctcagaggtgctgatgtgcaagct
atatctcagatgcctgtcaagaaagatgagattggaactggcaaaaaagcaggagctgtg
gctacagttgttgctgcagttgaccaggctcgtgtcaggctacctggatacacagaaggc
ggctatgctgaagaaacagctctgcagtatgaatacaaagagcatgtttctgctaggaaa
acagttgaattctcacctgagcgtcaagttgtcactaaacccataaaagcaccagatgtt
catgttccaaaagttgtccatgttgaacatgttccaacacctgtaccacagattaaaaga
attcctgagccgccaactgtaccagttgtccaagtggaacaaactatatcacatacacct
gttcctcattttaccgtcagtaaagttacagtccctaaacctgagcatacacatgaggta
tcaattgcaggatctgctatagccactctgcaacatgaattaacggcagtttcacaaaag
atcaccaagcatgtggaggctccacacctaaaactggctgaagcacgagcaacaccggaa
aaaattgtctctcaaccctatcctttggcagaaccagcggatgcttacaaaagccgattc
gatgctcaaatgaaaagggatataggtttgactgttacaggtggttattcgcgtgatgaa
agatttcagtaccagtatgaggttggttatcaagagactcttgctgaagaagcagcccag
gtgcctgaaccagctgaagtccccttttctccaccgactatagtctctggtctaaaaaat
gtaacagtccttgaaggcgagtcagtaactttggagtgtagcattgctggttacccttcc
ccaactgtggtctggtatcgtgaggattaccgcattgaaaattcaattgatttccaaatt
acctatgaacaagagattgtaagacttgtaattcgtgaagcattcgctgaagacagcggg
agatttacttgcacagctaacagcgaggcaggcacagtcagcacttcatgctacctcctt
gttcaagtgtccgaggagtatgaagccagagaaactgttactgaaaaaatgacagaagag
agacagtaattatataatgagagagatgtgaatatgaacagcattagttaattatctcat
tgactatctttttgcagatacacagaggagcagaagatggagatagaggtgactgctcct
gctgaaacaggagaaggagtagtgcccttcttcattcggaaaccaactgttcagaagttg
gttgagggaggccgtgttatatttgaatgtcagattggaggcaaccccaagccacacatt
tactggaaaaaggctggtgttcctttaagtactggatacagatataaagtgtcctataac
aaggatacaggagaatgcaaacttgagatttctatgacttttgctgacgatgctggagat
tacagcattgctatccgtaacaaacatggagaagctactgaaaccataagtcttttggag
gaagctgaatatgaccattacatgaggatgcacgaagagccgactccatttgtacctgaa
cccaaagtagctgaagccgcaccaactttatatcggacagagtatgataaggaatatgaa
aaggaacacgcccttatcagaaagaagatggccaaggatactactatcgttaagactaca
atttatactgaggaatatcagctgactgcatttgaagagaaacttatcaaagaaattgaa
tacagaatcattagaattaccttagaggaattacttgaagaagatggggaggaaatgatt
gtcgatattgaggaatctgaaataatagagtcaggatttgacataagacttaagagttac
cagatccttgagggaatgggagtcacattccactgtaaaatgtctggatacccattacca
aagatcacatggtacaaggatgggaaacgcattaagcagggaggccgctaccagatggaa
accttacaagatggcagggccagtctgcgcatctctgttttagcaactgaagatgagggt
atttacactgctttggccagcaatgttaaaggaaattccatttgctcaggaaagctgtat
gtggagcctgctgcactcactggaggtctagcttacataccagctccagaggctgttaaa
aaaataaggtctgtatctccacgctcaccaagccgctcccctgcacgttctcctggacgt
tcacctgctcgacgattggatgaaactgatgagtcacaattggagagattatacaagcca
gtatttgtattgaaacctgcctccttcaaatgtgctgaagggcaaactgcaagatttgat
ctgaaagttgttggaagaccaatgccagaaacattttggttccacaacggtcagcaaatt
gtcaatgactatacacataaaattgttataaaggaagatggaacacagtcccttatcata
gtcccagcattgccaactgattctggagaatggacagtcattgctcaaaacagagctgga
aaaacttcagtctccatgacattgactgtagaagcaaaggaacacttacaaagaccgcag
tttgttgaaaaactgaagaatgtaagtgtaaaggaaggctctaaacttgaaatgtcagta
agagctgctggtaaccccaacccagatattgtgtggctgaaaaacagtgatatcattgct
cctcacaaatttcctaatataaagattgaaggagctaagggacaagcagcacttaagatt
gaatctacagttggacatgatgctgcatggtatactgccactgccattaataaagccgga
cgtgacactactagatgcaaagtcaatgtagaagttgagtttgcagaacctgaacctgaa
agaaagctaataattcctaagggcacctacaaagctaaggagattgcagcaccagagcta
gagcctcttcatctacgttatggccaggagcaatgggaagaaggagatttgtatgacaaa
gaaaagcaacagaaacccttctttaagaaaaagctaacttcagtaaggctcaaacgtttt
ggaccatcacactttgagtgtcgtcttacaccaattggagacccaaccatggttgttgaa
tggctccatgatgggaagccattggcagctgccaacaggcttcgaatggtgaatgaattt
ggatactgtagtcttgattttgaggtagcctaccctagagacagcggtgttattacttgc
agggcaactaacaaatatggaacagatcacacctctgcaacattaattgtaaaagatgag
aagagtcttgttgaggagtctcagttgccagaaggcagacgaggtatgcaaagaattgaa
gagatggaaaggctagcccatgaaggtgcacttgcaggagtcacagaggatgtaaaggaa
aaacaaaaaccagaaattgttttgttccctgaacccgcaagagtttatgaaggagaaatt
gcacgtttccgttcccgtgttactggatatcctcagccaaaagtaaactggtatcttaat
ggacagctaatccgtaaaagcaaaagattcagactccgctatgatggcatatactacctt
gaaattgtagactgtaaatcctatgattctggtgaggttaaaatcactgctgaaaaccct
gaaggtgttactgaacatgtcgtgaaactagaaattcaacagaaagaagatttcagatca
gttcttaggagaagccatgagccaaaagttgctcctccatctgcagaagcagggaaagtt
ccatttgaagttaaaaaagtgactgaacctggggcaaaagaatttgtaaaacttaaaagg
attgaaagaataacccacgataaaatctctgaagaatcagaagaactgcgcagtaaattt
aagcgtagaactgaagagggatactatgaagctattaccgcagttgaattaaaatctcgc
aggaaagatgaagcatatgaagaaatgcttaaaaagacaaaagatgaccttcttcatata
acaaaagaactgactgaggaagaacagaaagcccttgaagaggagggcaaactcactatt
ccaactttcaaaccagacagaattgagctttctccaagtatggaagcacctaagatttta
gaaagaatccaaagtcagacagttgcccagggaggagaagctcatttctgtgttcgtgtt
gttggaaaaccagatccagaatgccagtggtttaaaaatggtgtcaaagtagaaaggtct
gatcgtatctactggtattggccagaagacaatgtgtgtgaattagtcattagagatgtt
gtggctgaagactctgccagcatcatggtaaaagcaattaatgtagctggagaaacctca
agccatgcatttttgcttgtacaagggaaacagttaataaagttcacagaagacttacaa
gatctaacggcaaaagaaaacgacagcatggctacctttgagtgtgaaacatcagagcca
tttataaaagtgaaatggtacaagaatggcgtggagattcactctggcgataagtacagg
atgcattctgaaagaaaggcacacttcctttctgtgctcacgattgacatgtcagatgct
gatgattacagctgtgtccttaaagaagaagaatctatgagaacaaccgccaaacttata
gttgaaggtactcctattgagtttactaggaagcttgaggacattgaagttcaagaaaca
caatctggagaacttgaatgtactatttctcttgaagacgcacagggtaaatggtatcat
ggtgatactgagatacagtccgatagcaaacatgtgattacttcccgcagagggcgccat
gttcttaccattaaagatgttacaaaggaagatcaaggagaatatagctttgtggttgct
gggaagaggaccactgcaaagttaaaagtgaaacctcgtcccatttcaattctgcaagga
cttgcagatcagaaagtatgtgaaggtgacattgctcaacttgaggtcaaagtgtccctt
gaaaatgcagaaggagtctggcttaaagatggagtggaaatccagcccactgatcgcatc
catattgttattgacaagaattctcatatgttacttattgaagatgccacagccgatgat
gtaggaaaatatagttttacagtcccaggtcttgatctttccacatctgggcggctgtcc
gtttacagtgttgagattgtcatccctttgaaagatgtccatgccatagaaggaacaaag
gctgtacttgaatgtaaagtttcagttcctgatatgacatcatctaaatggtctataaat
gaacacccggtcaaacttgatgatcgtgtgcaaactattgccaaaggagccaaacaacga
ctggtattctcaagaacccatgcttctgataaaggacaagtcaaacttctgattggaaaa
gtagaaactagctgcaaccttactgtggaaaaaattaccatcatcaaaggattgagtgac
caaacatgcactgagacacaaaatgtaactttgcaagttgagctgtcccattctggaatt
gatgccttgtggcttttcaaaaatgatgaactcaaaccaagccctaaatacaagattgag
tccaagggcaaaatatacactctaacaattacaaacatgatgaaggatgaagaaggccaa
tataccttctttgctggagaacagcaaactcgtggaaaagttactgtttcaggtggagct
ataagcaagccacttgtagatctaacagtagctgaatctcagaaagctgtttttgagtgt
gaggtggctaacccagactctaaaggacaatggatgagagaaggaaagccaataagtttc
agtgacagcatcaaaagtgaaaccataggcaggaacagacagcttataattcctattagc
aagcttgaagatattggtgaatacacctaccaggtagcaacctcaaagacttctgcaaag
ttgaaggttgaagctgtcaaaatcaagaagacactaaaaaaccagactgtgacagagaca
caagatgctatattcagtgtggaacttactcaccctgatgtcaagggagcccagtggatt
aaaaatggagttgaactagaatccaatgacaagtatgaaatcatagttgatggaccagtg
cacactttgagagtcaaaaactgtgttgttcccgacgagtctgtttacagcttcaagctt
ggcaaagttggagcaaatgcaaggcttcatgtagaaactgttaaaatcattaaaaaaccc
aaagatgtgacagctctagaaaatacaccagctacatttgaactcagtgtttctcatgac
actgtgccagtgaaatggtttttcaagaacgtggagctgaaatcaagtgataagcataag
attgtatctgagcgtaaagtccacaaactcgtattccagaacattattcctgaagatgct
ggagaatacactgcagtggtcggacagctggaatgcaaagttaaactttttgtggagacg
ttacgcattacaaagactatgaagaacattgaagtccctgaaaccaaaacagcctcattc
cagtgtgaggtgtctcatttcaatgttccatccatctggctgaagaatggagttgaaatt
gaaatcagtgagaagtttaagattgtggttcagggtaaacttcatcaattgatcatcacg
aacacaagtagtgaagattccgctgagtacacctttgtctgtggaaatgacaaagtcagc
gcaactcttactgtgaaacctatcctgattacatctatgttaaaagatatcaatgcggaa
gaaaaagataccattacttttgaagtcactgtaaaccatgaaggcattacttataaatgg
ttgaagaatggtgttgaaatcaagtctacagagcgctgccagataaaagccaaacaatat
tctcattctcttactattagaaatgtccactttggtgatggtgcagactacagctttgtt
gctggaaatgctgtctctaaagctaccttatatgttgaagcccgccatattgaattcagg
aaaccaattaaggaaataaaaattcttgaaaagaaaagagcaacatttgagtgtgaaatt
tctgaacctgacatgcttgttcagtggatgaaagatggccaagaacttcagattactgac
agggtgaagattcagagtgaaagatatgttcaccgtcttgtgattccctctgctcgcatg
tctgatgctggacagtactctgttgttgctggtggaaatatgtccacagcaaacttacac
gtggaaggccgtgatgtccgcatcacaactgctcacaaagagattcaggctgttgagaga
cagagagcagtggttgagtttgaggtaaatgaagatgatgtagatggccgctggttaaag
gatggtatcgagattaacttccacgtagaagaaagatatgagtacctcatggaaagacgt
gtgcatcgcatgagcatcactgaaaccaggataagtgacagtggagaatacactttctca
gctggaagaaataggagctctgtaacactttatgtgaatgctccagagcctcctgttata
atacaaaagctggaggatgtacatgtggaatctggcaaaccagctcgcttctgtactgta
gtgtctggcaagccacagccaactgttgcttggttcaaagattcaacacagctttctcct
ggtttcaagagcaagttccttcatgatggacaggaatatacactattgctcattgaggct
ttccctgaggatgcagctctgtacacgtgtgaagccagcaatgattccggaatggccagc
acttctggtactcttacagttgaagttccagaagtagtgtcccctgatctagaggcacca
gcctatcctcctgagatcatcacacctcttcgggatacaatcactgctgaagggcagcct
gcaatcttccagagttgtgtctctggcacagatttaaaggtttcctggtacagcaaagac
aaagagatcaagccatctcgcttctttaaaatgactcagtttgaagacacatatcagctt
gagattgcagaagcctatgctgaagatgagggcacctacacctttgctgctagcaattct
cttggccaagtctcttgcactgcaaatctcagactggaagctctggagagagttcttcaa
gagaggatagaacaacagattgaacttgaagtaaaagacgtgtctagctcttatgtaata
tctactgaggaagacacaacagaaaccttcagcagtggcctgcagttaaagcctaaaact
agaacacttgcatctatgcctgaatcgtctatttactcaagcaaattagaatttaaaaag
gaagctagtattccagttttcataaagcagctttcatcactagatgctagagtaggagat
gcagccacattgtcagttattgttagtggtttcccaaagcccagtatctattggaggcac
aatggagaagagctgagtacctctgaacgttacaaattattgtatgatggtgatgaatac
atttgccttatttcatgtgtggaaacaaatagcgagggagagtatacatgcattgcaata
aatgagcatggtgaaaccatttgtagctcatatgtcacagtaaggcagagagagagcata
gatatcagcaaacatcttgagacaactttaactctgaatggtcagtcaaaagatgataat
caacttattgcaccaacttttgttaagcctctacaatctgtttgctgtatccaaaatgat
aatgcagttttggaatatgaactcacaggaaatccaaagccaaaagttcggtggttcagg
aaaaataagcagatattggcagggaaacgtcacgccatttgcctgaagcaggatggaata
ggctctttgacagttcacaaatgtcaacaagaagacagtggtccttatacttgtaaagca
tttaacagtcttgggaagacatcctgcactgcagagctgtcagttgtcccgaatcctagt
atagctgacaaggagtcacagataaaagttactaagtcctacaagaaatcctctgttcaa
gaaagcactgaaacacgcctatatgctgttaagttaccgggagaagcagtgtctgaacag
gaacattctaccatgttgtacaccattggaatagaaggaaagtactctacacacagtgag
gaaggtgattcactacaggaagtgattaatttagaacaacagttagtccaacttaaccca
cagcctaatgagtacatgcttttagctacatcagcagtcacagagcttacagacgtaagt
gagcaaaatgtcaggattattataagtcctgttctggaagagttagacagacctaaatcc
caatcccttcatctagctgtcactgaagaaagtacactagcagataaggaaagagaagta
aatgataattacctatgtaccccacagttaggtttagcacatgaggaaaaatcaaggcat
attttagttacagcagaagaaaaacagcaaatatcgtgtgatacgacagcagcaatttta
gttggggaaaccactacagcagtatccacagctggagccaaagatgttttacatacccac
agtgtggaaattgttgaggaatttataaaagagcagctgcttggagatgaagtggcacag
cttttgcagatggaaaagcaaaatccatcttcaaaagtagacttggtattcttagaacca
ttggttaccccggtggtagattctcaacatattttggtaagggaacagaacctacatttt
aaaaaagcacaggaagaaaaggctatgcttatcaaagatcaacccataaaaagtggtttc
atgttagaagagaaacaccagcttccttatgaacaaacattgtctattcaagaaagggat
gctgaagaagttgctaagtgtgacctcgaactgagacaagtcatgcatttgcatgttgta
gaacctcacacacaactaccaagtgaagaaacattttgctttgttatgccatctgaagac
caagctgatataacaaaaagcccagtcttccttctgtcttccttgtctgatgaccatcgt
cctattttatgtgaggatactagtattataaaagattttagtgcagaagtaaatctgact
ttttcaaaagaacctccccctgttttaaatctgcaaactatacagtcggagttattgtta
cccaaagaagacaaagtgattatagaaaaattagaatcaaacactgccttaaccaaaatg
gagaaattctacaaacgtaccctacatgttgaagacaaaagcattttttcaggggagaga
ataaaagaacttcaaatattggctggacatgtacaacccatatctgttactgaacgtcaa
caacacaaatgtgcttttgcaatggaagctgttcttttattgtcaaaagaagagttagtt
gcaacagagaaggaacaaagggctgtagtacaaaaagatgactttcaacctgttacaaag
ctgtgcactacagttgaaagtaggactattgctgatggctatgctgattttgtgccagat
attgacataaacacgtgtcaagttactgaagaattgactcgtcctatagaaactacatgc
attgagaactatggtgtgccaatacaaagtgtaattcctttagatgaagcccagcaagat
tatgcatccagaattcaggaaggtcagtcagtaagtttgcctttagctgtagaggaaaaa
caagctataccagaggaacattcgcaaactgcagaacgatcagcaacagaaattttaaat
gtagaaactcaaccaaaagaccttttgcgcttacatgatgtatttgctgcaaatatcctt
cacaaagaacaacttttagtctcagaagatctaaaacatttcaatttagagataaaaggg
catgttagaagagctctgtattctgctttgataaataaatcagatattttgtctgcagaa
atattgcaaaatatacaaaacataaatgttaaaagcattaaagtaacaaaagaacctaag
aacaccttatgcacctatgtgattacaagtaattgttctattgaagaagtaacattgtct
cttccaagggtttatccacaaagcattgaccttaaaagtgaactcaaaacagcttttcag
gctgttatatttgaagaaaaacatatattggaagctgggagaccagaaagtatcatcact
atgcaagagaaagcctttattgccatagaacaacaacaaaaaatgtcgacagctacagta
gcagataaaccttctttctgtgatgcctataattctgtcaatataaagactgaagggtca
gaaacatatgagcagagcagagcaaaacaatcacccagtgctgttgagattaaggacatt
ggtgcagcagcttgcactgatgaagttacattttcaactgtgtccatacagaaacaagaa
cagatagtgaaaaagagagagacaaggcaagaaatatatgaggatgagctcttaaaagaa
tctgctactccattaattaggcaaagtttattagattatacagctaatgaaggggactgt
gttacctttagcacagttataaacagtgctaagactgttaactggtactttaatgataga
cttttgtcttcaggcatagagttcaagtgttcacaacatactgatacgtatacattagta
atcagcaaagtacaaatggatttacaccaaggagaatatatctgtgaggctttgaatgac
gctggcaaatcaacttcagcagctcaacttacagttgttaaaagagctcctgtgctgaag
aagaggatcgagactgtagaagtcgcagttggatactctgcatttttcacctgtgagaca
gaacctgcacccaatgttaaattccagtggttcaagtctggacgggaaatctatgaaagt
gacaaatactctgtgaagacatcaagctacatttctactcttgaagttcttagaccacag
gttgttgactgtggtgaatacacatgcaaagcttccaatcagtttggtagcataagcacc
actgcaaccttaactgtgactgaagccttccctccatcttttataactagaccagagtct
gttacttcttttgtgagtaaaaaagctaagttccaagcaacagtgtcaggtacacctgtt
attgatacaatatggcaaaaagatggacttcccatctccttatcagagagcattcaaatc
tcagccataaacaacaaacatgtcctagagttcttgaatcttaccacctctgataaaggc
atctattcttgcaaagcgtctaacaagtttggaacagacggctgtcaggcagaactgata
gttatcgacaagccacacttcataaaagaactggaacctttgcgttctgctgtgaacaaa
actattcgccttgagtgccaggtggacgaagacagaaaagtaacagtagcctggacaaaa
gatggccacaaactccttccagggaaggattataaaatctattttgaagaaaaagtggct
tctcttgaaataccagtagctaagataaaggattctggaaattatgtgtgcactgcaaca
aatgatgcaggaagcaactcatcttcttcagttgttacaatacgagagccaccatctttt
gtgaagaaggtggaaccctcttatttattaaggcagggagaatctgcacatttacagtgc
aaaattaaaggttcacctgatattcacgtcacttggtacaagaacaacacagcaattaca
ccaagcgaaatgtttagaatgacgttccacaactcagatgctgtactagatatcacaaac
atgaaagttgatgatagtggcagttacacttgtgaagctctcaatgacgctggctgcgaa
agctgcacttgcgaaattattgttaaagagccaccttctttcatcaaaacacttgaacct
gcagaaatagtgaaaggatcaaatactactcttcagtgtgaaatatctggtactggacct
tttgaaattagctggtacaaagataagaaacagataagaagtagtaaaaagtacaggctc
atatatcaaaagtcttttgcttgtctggaaatctcatcatttaatagtgcagatgttggt
gaatatgagtgtgttgttgcaaacgaagtgggcaagtgcaactgcagtgcaccatacagg
cttaaagaaccaccatcatttgtgaagaagattgaaaatgtcactgcaatagttggcaac
aatgtttccctacaagccgttgtaaaaggctctgaggtcatcatggtaacttggatgaaa
ggaagagatgttgtcagagaagataacaaagtcaaaatcacatttgacaataacattgcc
actcttcatatcagcagtgtgcaaattaacagtgctggaaaatacacttgtgtggctgaa
aatgaagcaggaagccaaagctgttttggagaattaatggtaaaagaaccggccaaagta
gttgagaaagctgaattaatccaagtgactgcgggagatcctgcgactttagattgcact
gtatcgggcacacctgaacttaaagttaaatggctaaggcaagggaaagagataacttct
ggcaaaaagtataggatcagttttaaaaataatgttgcctccttgaaattttacgctgct
gaaattcaggacagtggagaatattcatttgaggtgtccaatgatgtcgggagtagcagc
tgcaagatcacttttacagtattagatcgaaccattgccccatcttttactaaagcattg
caagatattgacaatgtagtaaacgtaccatgtcgattggaatgcaaagtctccggttct
ttgcccatgaaagtggcatggtttaaaaatggggaagaactaactccagacaagtataag
atatcatttgtggaaggtactgcctttttggaactaagtcgactagaattgagtgatgct
ggaatttatacttgtaaagcaacaaattcagcaggaagcaaggaatccaaaggaactctt
tctgtcaaagaacctccaagctttctaaccaaaccagattcacaagataccctgccgggg
tcaactgtgtgtctaaaaacaacttttaagggaacaccacctttgtcattaagatggttt
aaaggtgtggaagaaataaagacaggaggttcttgctacattgctaaggagaacacaagc
agctctttggaactctatgcagttaaaacatcagaatctggaaattatgtctgcaaagtc
agcaacgtggctggcactgtggaatgcagtgcaaacatatttgtaaaagaaccagcaaca
tttgttgagaagctagaaccttcacagcttttcaaaaagggtgatgctgtacaacttgaa
tgtaaagtagctggaacaccaactattagtattacctggtttaaaaatgacaagaaaatt
aaagaaagtgatgcttgcagtatgtcattcttgaactcagtagcatctcttagcatttac
agtataaatcttgaagacatcggggaatatgtatgccaagctaaaaatgaggctggtaca
gacacatgcagctgtgcggtcatagttaaagaacctccttcttttgtaaaggaatttcaa
aatgttgaagtactgagagattcagatgttattttggaaggtgcattggtaggctcagct
ccatttgagatttcgtggttcaaggacaacaaacctattcgaagtggtaggaagtacaaa
accttttttcaggacagtttactaagcctcagcattctaaggtttgactccatggatact
ggagatttccaatgtagggtgtttaatgatgttggaagctgcctgtgtagctctcttgtg
actttaaaagaaccccccacttttacaaggaaaatcgaaaatcttagttctctcattgga
ggaatggttgccttccagtgttctgttaaaggttcacagcccatgtccatatcatggtgg
aaagacaatgatgaagttatggaagatgaaaacttaaaatcaatatttaaaaacaatgta
gccacactacacataacttctgttaagcgtaaccgtggtggcaagtatacatgtgaagcc
aaaaatgaggcaggcattcaacgatgctctgcggtcctagcagttaaagaacctgccaca
attattgacaaagctatctctgttgatgtcacagaaggtgaccctgcgaccttgcaatgt
aaattttctggaactaaagaaatcacagccaaatggtttaaagacgggaaagagctaaaa
cttggtccaaaatataaaattagctttactgagaatgtgtctgtcctgaaaattatttca
gcagacaaaaatgatagtggagagtatacatttgatgtgcagaatgatgttggtagaagc
tcttgttctgcttctgtcaatgtattagatctgataatcccaccatcatttacaaagaaa
ctgaaaaaaatggacagcgtcaaagggtcttttgttaatcttgaatgtatagtttctggc
tcacatccaataactgtgaaatggttaaaggatgacaatgaaattcagccttatggaaag
cacaaatattccttccacgataacatagcctttatggagattaatgaattagaaggatcg
gacagtggaacctacacatgcattgccataaataaggcaggaaagggtcaatgcagtgga
tacttaactgtgaaagaacctccctattttactgaaaaacctctttcacaagacactctg
ccaggttctagagttcagtttaaaactgtcttgagtggcaccactccaatggtaatcaaa
tggtttaaggatagcaaggaactcctgtcaggagcaaatcgatcagtttggaaagatgaa
tcttcaagtatccttgaactgttttcagctaaagttgctgattctggaagttacacagtt
caagttagcaatgatgttggcacagttacttgcaaagcaacactttttgtaaaagagccc
ccacggtttgttaagaagccaagcccaatcttgttgttaaggaatggagagtcaacaact
ttccagtgtctaattgctggcacacctgaaatcaaggtcatttggtacttggatggaaat
gacattacgacaagtgacagatacagtatttcatttattgatggaatagctaatcttgat
attatcaattctactattgaagacactgggatgtatgtttgtgaggccaccaatgaggca
ggtagtgagagctgcagcattgatgtcaaagtgaaagaagcccccacttttaaaagtgta
tttgagccagctgacgtagtgaaagcttctgatgtaaagttattctgtgaagttctgggc
actccaccatttgatgtaactttttcaaaaaacaagaaggagattcggagtggtaaaaaa
tactctttggtccaaaaggattcagtatttgagctgcacattttcaacgttgactattca
gatgctggtgaataccagtgtacaatatcaaatgaagcagggggctgtcattgcagtgct
tcagtacatttaaaagagcctccaacttttgttcagaagatagaaaatgctactacaatt
cttggaagtgctgctgcttttcagtgtgctatagcaggttcagatcctattacagtgtct
tggataaaaggagataaggttgtagagcaagatgacaacacacatattacctttgagaac
aacatttctactctctatatcaggactgttgatgccagtcatactggtagatatacctgc
caggcttccaatgaatcagggacagagaaatgttttgcatctcttatagctcaagagcct
gcagagatagttgacagacctaaatcagtaaatgtaactgaaagagatccagtgacattg
tattgtactgtggctggaacaccagagctccaggtcaagtggtacaaagaaggcagacag
attatgccaagcagattttttatgctaagctttgaggataatgtatccagcttgaggatt
cagtctgcaagcaaggaggatagtggagaatatatgattaaggttgaaaacgactttgga
agcagtagttgtacggcttttgtaaccgttctggatcaagctattcctccatcttttaca
aaaaagttaacaaaaatggataaggttcttggatcttccattcagatggaatgcaaagtt
gctggttcattgccaataaatgcacaatggttcaaagatgggagtgaaattctgcacagc
gcaaagcgcaggcttgtttgtcatgaaaatatagtgtctttgaccattgctgacctagat
gtatctgataatggcaactacaagtgcaaagtaatgaacgtggccggacgtgctgaatgt
agcgccatcttgactgtaaaagaacctccaagcttcattttaaaacctgaaagtcaaaag
gcaatacctgattctttggtggatttcaaggttgaagtaaaaggaacaccaccattctca
attaaatggtttaaagaagacatggaactcttttctggacctaaatgtttccttggaatg
gaagggtcaataggtttcttaaatcttttcacagtggatggcacaagcactggacgctat
acttgccaagttaccaatgatgttggtagcgacacttgtagtacaatgttggttgtaaca
gaaccaccaaagtttatcaagaagttagagtcaacaaaagtaaccaaacaaggtgattct
gtccgctgtgagtgcaagatcagtggatccccagagatcaaaatcacctggtacaaaaat
gacagtgaaattaaggcaaatgagaagtacatgatgtatttcattgacttcataccagtt
cttgaaatcaacaacctcagcattgaagatagtggagactacacctgcgaagccaataat
gatgctggcagtgccagctccagtatcaagattgtagtcaaagagcctcctgtctttagc
aagaagcctagcccaacggaagtcctaaaaggcgtggatgttagtcttgagtgtgaactc
ttgggaaccccaccttttgaagtgatttggtttaaagatcgcagacaaatcagaagcagt
aaaaagtacaaagtaacttctaaaaatcaccttgcttcggttcacattcttaatgttgag
gccccggatattggagaataccactgtaaggcctccaacgatattggaagtgatacttgc
atttgtaatataaaacttaaagagccaccaaaatttgtgaagaaagttgaaagtgtaact
gttatcttggatgaacctcttgaactacaaggactgatcgagggctcacaacctatttcg
gttctttggttgaaggacaaggaagagatcgtcagggagagtgaaaacattaagatttct
cactttgagaaccttgcaactcttcagattagaaaggcagaaccagctaatgctggaaaa
tatatatgccagataaaaaatgatgctggaatgagggagtgcatagccaatgtgtctgtt
ctagaacctgcaaaaatattagaaaagccagaacctgtaagagttactgcaggtgatgtc
tgcttaatagaatgcatagtaacaggcacaccagaactttcagctagctggttcaaagat
ggcaaagagctgaccagcagtcaaaaatataagatcagtctatccaataaggtagcttca
attaaaatcatgtctactgacaaaagtgacagtggagaatatacatttgaagtgaaaaac
aatgttggaaaaagcacctgcaccgcaacagttgatgttcttgatcgtgtattacctcct
tctttcaccaaaaagttgaaagaaaccactgcagcagtaggttcctccattcaaatggaa
tgcaaaatcactggatcaccgcctatctctattacttggcttcacaatggaagcaaaatc
ttcagtggagataaacatgagcctgacttttccgatagtctttgtgttttaaaaattaat
aacttggaatcctcagatggtggaaagtatacttgtgtagcatcaaacattactgggact
gatgagtgcagtgcttctctaactgtccaagaaccaccttccattgtgacaaagcctgaa
ccactggaagtcttacctggaatgaaagtctctttcagatgtgttattaggggaacacct
ccttttaaggtacactggtttaagggaagcagtgaactaatttctggaactgcatgtctt
ataaaatttaaagattcagattccatcttggaattatatgacgtggataccgcgcacagt
ggggactacacatgcgtggtttctaatgatgctggaaaggactcatgcactacccaactg
gttgtaaaagaacctgctacctttgtgaagaaaattaaagactacaatgttgaaactgga
aaaccatttattttggagagcacatatactggcacacctcctatttatgttacttgggaa
ataaatggtgtagagataatacaaactgaaagatgcaacctaacaacaacagaaaaatct
tgcattcttgaaatcttaagtagctctaaagaagatgatggtgaatacacttgccgggtt
gaaaatgaagctggacaggatatttgtcaatctatggtgaccattctagaaccaccatac
tttattacaagtattgaagatgtggacgtgacagttggtgactcaacatctttgcaatgt
caagttggtggcactccagaaattgttgtttcttggtacaaaggagatacaaaactcagg
tcaactccaggatgcaaagtgtacttttcaaacaacgtagctactcttgctttcagcaaa
gtcgacaaaaatgatagtggagaatatatttgcaaagcagaaaactctgtaggatctgtt
tcttctaaagcagtttttaccgttcaagaccgtcaacttccaccttcatttgccaggaaa
atgaaggatctggaggtaacacttgggcagccagttaaatttgattgccgtattaatggt
tcagaacctattgaggtgtcttggtataaggatggcgtacctttaactgaggacattaac
gtccaaatgtcatttgtaaataatgtagctactcttcgcattctggaattagagaagggc
catgctggtctctattcttgtacagcaaccaacgcagtcggtactgcttcttcttctgct
aagctaacagtctcagagcccaagaaaccacctatctttgataaaaaagcggaatcagta
ggtgctgtgcttggggagagtgcaggctttgaatgccttgtttctggaacacagccaatt
aaggtgctatggaccaaggataacaaagaaattaaaacaggtggaaattataacatctcc
tacattggcaacacagctcacctgagaattataaaagtgggcaaaggggattctggcatc
tacacttgccatgcaaccaacgatgttgggaaagaatcttgttcagccgaattgagtgtg
aaagaacctccaaagtttgtaaagaagctagaaccttcacgaactgtcattcttggtggc
tctgcccattttgattgcaagattagtggatctccagagattagagttgtatggtacaaa
aatgacactgaactacggccaagtgaaaagctcaatttatcttttgctgacaacgtggca
cttcttgagattaacaatttcagtccagaagacagtggggattacacatgtgaagctcac
aataatgctggtagtgcaagctgcagtacatctatcacagtaaaagaaccccccattttt
gttaggaaacctagcccggtggaggttttgaaaggtgttgatgtcagttttgagtgtgaa
ctcttgggaactccaccatttgaagttgcctggtacaaagataggcgacagatccgaagc
agtaaaaagtttaaactcacttccaaagacacccttgctagcatccatgttcttaatgtg
gaaccagctgatattggtgaataccagtgcaaggcagtcaatgaagttggaagtgacaac
tgtgtctgtgctatcaagttcaaagaaccaccacgatttgtgaaaaagctcagcgatgtc
acttgcttttctggtgaaataactgagtttcaggcagttactgagggctctcagcccatt
ttaattacttggctaaaggacaaaggagagattgtcagagagagtgaaaatgtcagaatc
tcttatgtaaacaacattgcatcattgcaaattgcctgcacagaatcttcaaatgcagga
aaatacacatgccaggccacaaatgaagtgggctcccgggaatgtgcatctcttctttct
ctaatagaaccagcaagaattgtggagaagccagaaccaatgagagtcacagctggtgat
acctgttctcttgagtgtactgttgctggatcacctgagcttataactaagtggtataaa
gatgccagggagataagaaatgatcataagtactccattaccttctctaacaagaggtca
acgcttaagattctgtctgctaacagggaagacagcggggcatataccttcgaagttatg
aatgatgttggtgaaagcagctgtacagtctcagttgatgttcttgatcgtgtcatacca
ccatcttttaccagaaaactgaaagataccaacagcgtcttgggatcttctacacgattg
gaatgcaaagtttctggctctctccccatttctgtctcttggtaccaaaatggcaacaaa
atcgttaggagtgacaaatatgatatcacctttacagataatacctgtgccttaacagta
aattcactgggggctgcagatgttggaacttatacatgcgaagctgctaatgtggcagga
actgatgaatgcagtgcgtccctgacagtccaagaaccaccttcttttgtgaggaaacct
gatccacaagaagtgttaccaggctcaaatgttacctttaccagtgtgattaaaggaaca
ccaccatttaaggttaactggtttagaggaagtagtgagctggtgcaaggacctaactgt
aatatctccttgcaaaattcatttgctgcattggagttgtacaatgtagactcaatacag
agtggtgactatacttgcttggtaagaaatgatgccggcaaagactcatgcacaacacat
ctccttgtgaaagctcaagcaacatttgtgaagaaactgaatgatactagtgttgaatca
ggcaaagctatcactttggaatgtacgtatgtgggttctccaaccattatggtcacatgg
aaaaagaatggtagagaaataagccagtctgaaaggtgtagcgtaaccaccacagaaaag
tcttgcctgctggaaatatttaatgccacacaaggtgatgatggagagtacacatgcctg
gtggcaaatgaagctggccaagacacatgtagtgccttgttatccattttagaaccacct
tatttcatttcacctctggaacaagtggaggttaccattggagaaagtacatccttacaa
tgtcaagtaggaggaacaccagagataaaagtatcttggtacaagggagacactaagcta
aggtccacccctgcttacaaaatgcagttcaaaaataacattgctacattattcttcaac
aaggtggaaaagacagatagtggcgaatatatctgcaaagcagaaaatgttgttggatct
gcctcttccagtgctcttttcactgtgcaagagcgtaaggtggcaccatcatttgcaagg
aaatttaaagatgttcaggaaactattggcttacctgttacttttgactgccgaataaat
ggttcagaaccaattgaggtttcttggtataaggatggtgttcttttgagagatggcaat
aatgtgcaaacttcatatatagacaacattgctactcttcatattttgagcactagtgtt
gaccaccttggtcagtattcttgcacggctacaaatcccattggttctgcatcttccagc
gctaaacttatcctcacagaacccaaatcagctcctgtctttgacattaaacctgagtct
atcaatgttcctcttggagaagctgccgtttttgaatgccatgtcactggaacacagcca
atcaaagtctcttgggcaaaagacaacagagaaattcgccccgggggaaactacaagatc
acttttacagaaaacagagcacagttaaagatcctgaaagtcagcaaggtcgatgctggt
gcttacacatgttatgccagcaatgaagttggaaaagactcttgctcagcctctcttgat
gtgcaagaaccaccacgttttgtaaagaagttggagtcttcaaaggtcatcaagcaagga
gattctgataggtttgaatgcaaaatcagtggatcacctgagattagagttgtgtggttc
aagaatgatgctgagatccaacctagtggtaaatatgcaatgtcctttgttgactccgtg
gcagcgttggagataaccgatgcaaacattgatgacagtggagactacacctgtgaagca
cacaatgatgccggcagtgccagctgcagtggttcactaaaagtgaaagagccccctgtc
ttcattgaaaggccagaacctgtgctaacattaaaaggacttgatgtaactcttaaatgt
cagctgaatggctcacctccatttgaagtctcctggtttaaggacagaagggagattaag
agcagcaagaaatttaagatcataacagagaattaccttgcctctatacatatcctcaaa
gtagatgctggtgacattggcgaatatcaatgcaaagcagcaaatgatgttggaagtgac
tcctgcttatgttccattaagctaaaagaacctccaagatttgtccagaagcttgaaaac
tttacttcagtggttggagagccagctcaacttcaagctgtagtcgatggcaccctaccc
atcactgtagcatggctgaaggacaaagaagaggttgtcagagaaagtgaaaacatcagt
ttttcatttgtcgataacattgcaaccctaaactttgcaagtattaaaccacagaataca
gggaaatacacctgccagatcaaaaatgaggctggtgcacaagaatgcttttccagctta
tcagtgttagagcccgcaataattgttgaaaagccacagccaacaaaggttactgcaggt
gattcttgcaccctggagtgcactgttggtggaaccccagagttgataaccacctggttt
aaagatggaacagaactgacaagtgatgagaaatacaaagttagcctctttggcaaagtt
gctagcctgaaaatcctttccaccggaacaaatgacagtggggaatacaagtttgaagta
aagaacaatgttggcagcagcagctgcacggccattgttgatgtctcagaccgaattatt
cctccatctttcacaagaaaactaaaggaaacatatggcgtacttggaacaacaacctcc
atggaatgtaaagtatctggatctccacctattgtagtttcttggtctttcaatggaagt
gaaattgtcagtggagacaagtaccagaccaccctcacagataacacttgcacactgaaa
gtcagtgatttggcgccattagatactggaaaatattcttgccatgctacaaatgttgct
ggatctgatgaatgcagtgctgttttatctgttagagagccaccatcattcatggagaag
ccagaacctgtggaagtcctcccaggcgccacagttacctttgctggtgtgattcgtgga
actccaccattcaaaatttcttggtataaaggaagtgatgaaatcttgccaggaagcaac
tgcaatattacactgactgagtctttggcagttttggaactttacaatgtcaacagccta
caaagtggggaatattcttgtcatgtcagtaatgatgctggaagggactcatgctctact
caactctttgttaaagaacctgctgcatttgtgaataaactcaccaactatcagacagat
actggcaaaccgattattcttgagtgttcttatactggaactcctccaatatatgtgaca
tggaagaagaatggccttgaggtttctcagtctgagcggtgcagcataactaccacagag
aagtcttgtatcctggaatattcaagcagcacaaatgatgatgatggcacatatacttgc
catgtagaaaatgaagttggacatgatacttgtcaagcaacagtaaaagttttagaacca
ccatatttcattacaccactggaaccagtagaggtcaccgcaggtgatgctgcttcattg
caatgccaaattcaaggaacaccagaaattaaagtagcatggtacaaaggcgatactaaa
ctgagaccaacaaatacttgcaaaatacactttaaaaacaatgtggctacgcttgttttc
tctcaaacggatgtgcaggattctggtgaatacgtatgcaaagcagaaaatccaattggt
actgcctcctctgctgctcttttgacagtaacagaacgtatcgttccaccttcctttgca
agaaaagtgaaggacatacaggaaactgttggcttacaagtctcatttgaatgtcaaata
gttgggtcagaacctattgaggtttcttggtataaagatggtgtacttttaagagatgac
tataatattcaaacatcatatatagataaaactgctacccttcaaatctttcaaactgac
agacaccatgctgggcagtatacttgtaaagcttccaattttgttggaactgccacctct
aatgccaaactcattctgacagagggtagaaacccaccattctttgatgtgaaaccatca
ccagttgatgttcctgtaggagatcctgcagagtttgggtgtcatgtgacagggacacag
cctataaaactgacttggaccaaagacaacaaagaaatcaaaactggaggaaattacaag
gtcacccaactggagaacacagcaaaacttacaattctgaagacagacaaggctgattca
gggcagtacacatgttctgccaccaatgatgttggaaaagattcttgcagtgtcaagctt
aatgttcaagaacggaaagtggttccaagtttcacaaagaagctttctgaaactgtcgag
gagacagagggcaactcatttaaactggaaggtcgtgttgcaggctcacctccattcatt
gtttcttggctccaaaataaccaggaagtccagcaatcagttaacagtgaaatctctttc
aagaacaacgtagtgctccttcaggttaaaaagtccagtcaggcaaatgctggtctatat
acttgcaaggtgtcaaatgatgctggaagtgccctgtgcacttctgcagtacttatcaaa
gaacctaagaaacctccagtctttgacatccctctatcacctgtaactgtcgcagaggga
gagggcttgcagcttagctgccatgttgacggatctcaaccaatcaggagtcagtggctc
aagaatggccgtgaaatcaagtcttctaatacttgcagtgtcacctttgttagaggaact
gccacattagaactgaaagctgctgctaagggagatgccggagattatgtgtgcaaagcc
accaactctgcaggaagtgaatccacaacatctaaagtcacaattaaagaaaaagcatct
gcagcagcagcacctgtgaagaaagcagcaatcgaaggaaagctattctttgtttctgaa
ccaggcaatttaaaggctccagagaagggcactgcaacattcattgctaaagttggaggc
gatccaattcctaacgtcaaatggatgaagggcaaatggcggcagatcaatcacggtgga
cgcattgtggttcagcagaaaggagatgaggctaaactggaaatcaaagatgtcaccaag
actgattccggacagtacagatgtgtggccttcaacaaacatggtgaaattgagtgcagt
actaacctctcagtggaggaaaggaagcaagagagctttgacggtgacctcagggccaaa
cttaaaaagactccaacaaaaaagaaggaggaggaagaagagaaagccattgatataatg
gaactcttgaaaaacgttgatcctaaggagtatgaaaaatatgcccggatgtatggcatc
acagattttcgtggtcttcttcaagcttttgaacttctcaaagccagcagagaagaagaa
agccgcagaatggagcttggaatggaggaacgttctcatacagaagagcaggaatttgat
gagcttgtttcattcattcaacaaagaatgagccaagctgagcctattaatttagtcaaa
gacatagaagatcaaactgtgcagacaaagaaagaagcattgtttgagtgtgaaatcaag
atcaattaccctgaaatcaaactttcctggtacaaaggaacagtaaaattggatacaaat
gacaaatatgaaattggtatccaaggagatcgtcatcatctcagaatcaagaactgtcag
ttggaggatcaaggaaattaccgtgtagtatgtggaccacacattgctagcgccaagtta
actgtgattgaacctattgttataaagcctctccaggctcattccatcaaggagggacac
agtagcactctgatttgtgagttctcaattccaaatgtgaattctcagtggtacagaaat
ggaaaagtaattgaccctcggggaagatatcaaacagaggttgatgagaagattcacaaa
ctcactatccaagatgtaagaacagaggaccagggacagtatacctgtagatttgaaaaa
ttggaaactactgcagatctttttattgaagctgaagctattcagtttacaaaaacgatt
cagaacattgttgttagtgagcacgaatctgccacatttgagtgtgaagtatcgttcgat
gatgctgtggtgacgtggtacaaaggaaccatggagttacaagagagtgcaaagtacagt
tttagaagcgagggccgttggcattacatgaccatccataatgtaacagcagaggatgaa
ggagtctattcagtaattgccagccttgaaccaagaggtgaagcaacaagcacagctgaa
ctgtatctgactactaaagagatgaagttggaactcagaccaccagatgttccagatacc
agaataccatatatacctgctccagttgaagaagagttcataacagaagctcccaaggct
ggtgttaaggttcccagggatgttacagatgatggagaggcggttccaccaactaaaatt
gctctagtgggcaagaaacaaaaagtcccagctccacctgctcctccttttcctgcacct
ccagctaaagttcctgcaaaaccaagaaaagaggatgaggttaaaataattaccgtagcc
aaaaagaaagaagaaatataccagaagattcatgaaccagaaccgtcttatgaagtagaa
gaatatgctgaggaggaggaagcatatgaggagtatggcagggaagaagaggtttatgag
agacatgtctatgaagaggaaaaggaatattatgaagaacaagtctatgagagaaagaaa
gagtattatgaggaacaagtatatggtggaaaagagcagtactatacagaagtaattgaa
gaagagattccagaaataaggatttctgaagctgaatataagaagcccggcgttactgca
gtgccagaaaaaagggcaactggggacttctattatgaacaccaagtagaggagactgca
gtagtcacagcacctacagtccatgagaagatggttgtagaggagagacgagcggtgtct
gtctcccgcacagaagagatttctgaagctgttcctgtagaaaaagtaccggcacctgtt
cctaaaaaggaagaagctccgtcagctagagatgcacgaaagaaaccagtcccagaggaa
aaagttccagctgctgctccaaaaaagccagaggttattccttcaaaagttcctgaagcc
cccaagaggcctgttccagaggagaaaatacccatcactgtgcctaaatgggaggaacct
cctgctgcagttcctgaacttgttaagaaaccaaaaattgctggcaagatgccgatagct
acccctcaaaaacctgaggcttctccagcaagagtgtcagaaattgaaaagaaacaagaa
gaaaagatacgtattatttccaaaaaggttgaagctccggcacctacagtacctggtgtt
ccaaagaaacccatagaggaggaaaagcaaatcataatctttgccaaaaaagaagtcacc
actccagtctcagtggtttccagaaaagtaaaagaagcccaggtagttactgtaaaacga
gaggagaagcgagggataattgaacgtccttctttcaaagataaagaagtgtatgaagaa
gtgtataggaagcaagaggccaccttcaaggagcgtgtgtatgaagaaagagaagaaatc
tatgaggaagaaattgtatcccctgaagaagaaatttatgaggagcctgatggggaagta
gatgaaatctatacaacaaggggatatatttataaggaagaggctcctgaagagcagtat
gaagaggctgctgaagaatactatgtggaggaagctcctgaagaaacctatgaagaagag
gtcactcgtgaagaagaaagatatgaagaaattatctatgaaaccaggcaaacagcctat
gaagaaaagatatacaaaccaatagaagcttacgaggaacctgaagcagaaaaagaaagt
ttttaccaagcagtagatgtagtttatgaagagaaagaaccggaaaaacctaaaaaagta
attccagctgaaaaagtaccaactgttgtcattaagaaggaaaaaatcactgttgaaaga
gtgcctggggaaccagagaaaccaattttgaaaggaagagaagctattactgtatctaaa
aaagacgttgctcatattgaagtttcaaaggacattaaaaaagttgttactgaagaaaga
ctaccagaggaagcaccaaaagtgaaagttccagcagcaaaagtgcctgagaaaccaaag
atacctgtgcctgaagaaaggctgccaactcctcctgcaaagaaggaagaggttcctcca
agcaaagtaccagaagtacataagcgagccatacccgaagaaaaggttcctgctcctgtg
cctaagaaagaggaggttcagcctcctaaagtcccagaaatacacaagaaaactcttcct
gaggaaaaaatagttcctaaaaaagaagtaccagctcccccagtttatttttttattaaa
ttcccccaagtggtcaaaaaaatagaggcgaaagtaccagttcctgttgctaagaaagat
gaagctcctccagccaaagtccctgaactgagaaagaagcctgtaccagaagaaaaagta
ccagtacctactcctaaaaaagaagaggttgcacctcccaaagtgccagaagctcctaag
aagattattcctgaagaaaaagtgccaaaagttttcccagaaccaccaacccctaaagta
ccagagccaccaaagcttccaactcttaaggaaaaggctccatctattcaaaagaaacca
acaccagtagaagtggcagaagctccccctaaagttgcgcctgagcagaaaatacctact
cctatttctaagaaagaggttcctcctgcaccaccacctccatccaaagtggttgaagtg
ccaagagctgtggaagaagagaggccacctgcatttgtccataaaaaagaagtaatcact
actgtggaagtggtggaaaacgtgacattagctattgaagtaccagacgtacctcctcct
cttgtggagaagaaacgtattccaccaaagaaagtacctgagatgcttcaacagccactt
cctgaagagaaagtgcgtcgtacaattcataaaaaagaaatagttcctcaagcagaagaa
catcttaaagaggaaaaactgcagcaaactcttcctaaaaaagaaattgtttctccagca
caagttgagatgcacccaaaagcaattcgacaggaggaacaacttatagtatctgaaaga
aaaacagttttagcagctgaagttcctgaggctccagagatgagggttccagaaaagaaa
attctgaagcctaagaaagatgcgatgcacactgctggagagatccccaaagaggcagaa
gaaaaatttccaagggttgttagcaaaaaggaagtaatccatcatgttgaagtctctgag
gtgcctgataagattgcccccgaggagaaaatgtttacaaggcctacaaaagaggcaaca
ccaagtcttgaagtgcccatgaaagttcctaggaagcctatagacgaagagaaaaaaact
gttacagattacacaagagaagtaatctcttcagtggcagcacttgaagttccaacaagg
atcccatctgaagaaaacaagcaggttacagttcacaaacatgaagtgattgtgtctgca
gaagaagtatcaaaaaaaccaagtgcaaaaggaaaagtgccagcttctaggaaagaaaag
acttcgtatgttgaagccaacatatctgaaagaggtggctctgaggaaatgccccaaatt
gctgtttccaaaagagaacctacttcctatgagcaagatgtaccaaaaacatgcagaact
gaagaaagtcctcatattggtgtatctaaagaaggaaccccttcctctctggaagattcc
caaataaggattattcccagagagaaatcactaacacttataactaaaagagaagttact
tctcacgaggaagctgagatacaagagaagcagagtcttttcaagaagccggaaaagatt
atacttaaaaaagaagtcactcataagcaagtgtttgatgaacaatgggaacttgtccaa
gaagaaaaaatattcactaaaccaagagaaatcgatgtttatacagaagaggtccagaag
gaggtgattcctgaagacaagtttcaaattgctgctcaagctactcttgaaactgaatat
cattatattgaagagctgaaggtcccaaaaaaaccatctcctgaagaaaaaccagtgatt
gcagggcaggtacctggaagagatgccaactcaatcaaaaaagcaacagttgttcagaaa
acaccaaaagctaaagacagaccgacactaactgcaccagagaaaaaagttgttacagat
gaagaagaggtcccaagacaactggactctgaagacaagattctaatttctttacctgaa
aaggaagttatttctgcagagaaagcgaagttacaatttgttatctttaaaatagtggaa
cagccacaaccaacacctctaaaagaaaaagcaccaactgccataaccaaaaaggaagtg
aagtctcctgcagaagtgcctgctactccaaagaaaccaatcccagagcagaaaccagct
atccctgctgctaaaaaggaagtagcagctcctgttgaagctgcagttggcaaaaagcct
gttccagaggaaaagcgcctgcatgttcctaaaaaacagattgtcccttctgtagaagtg
ttgccaacaaaaccagttgtagaagaaaaaaggtctgtcgcagttcccaaaaaagatgta
gaaccttccgtgaaagatgttcaaaagaaactgatcacagatgagaaaaaagtaataatt
tatgagcacaccgaggtggtaccttctgtaaaagtcccaacacaacagaaaaaggctatt
gaagagagaacaaccgtccgtgtagctaagaaaggcactgttccagtgcctgatgagaag
cctgcttttggaaagaaaccttatgcaaaagcacctcctttgacagtggcagacgttgta
aaaccagtgacaccacatgaggaagtacctgtgattctgtctgaggaagaagaagaatat
gagctagaggatgaagattatgaatttgagaagacaactattgagacaccatctcccctg
aaaaaagaggagacttttagaattgaagttcctgaggtcaaaaagaagattgtgcctgga
aagccaaccccagctgaacctgaaaaagtggaacttaagcctttcaaagtacctgaacca
gaaaagaaagttttcactaaacctaaaccagggattccacctcctagaaaagaagaaatt
agttttaagaaagttctaaaaccagccaaaaaggaagttgaagagcctcctgctgtaaaa
ccagttgagaaggttaaaaagcctgaacctacagtggagaaaaagccagaagttcctgaa
gtccagaagaaaaagttaccagaggtcacaccagctgtaaaaaaagaagaggcaaaacat
gaaccacctaaagttccagcagaagctaaaccttcaccagtgaccatgtccccgaaagag
ccatcacctgtacaagctgttccgtcaccaaaaggagatgaggctgccattacagcacca
gttacaactccagtttttggaaagaaagcagtcacagaaaaacctggtgtgccaataaag
ataatgcaaaaaggtaaaatgctgactgaagaaagcaaagtagaagcagttcggagagtg
cctttcctctctagtgacatttttattcctattgaagagcatgtaagctttaaagcagaa
agactatttacagatgtaattgaagaggaaagaaagatattaaaaaaggaagcagaaaag
gttcacataacttccgaggtgaaggtatctgaacattgggagtctgaagaaattgagtac
atggaagagattacagaggaggaagataatgctaaaccagaaaaagatttaaaaacaaaa
ggcatagtagaggacaagaaaaaaaggcatgagaaaattattggacatgaaaaagattcg
gttgagctagcaccagaaaagctaatcactgaaataaagtcaaaattagaggaaaaagtt
gaaggcaaagaaaagaaaccagctgaaaagaaaaaagataaagaaataattgctgtcttg
ccagaaaaagcaacagagaaaatcaaagaggttaaaaaagaaaagaaggatgaacaactt
agaaagataagtaagaagattccccagcatgaactcagtatttctactggggaggaggaa
gaaaaagttgaatctagtagtgctgaaagtgatgaggagttagaggcccatgaggcacaa
attaaaatatccaccaaaaaaactaaagaaactaaatttcacaaacctgtggagaaggac
aaaaaaataatccaaaaagctataccaaaagaacctgatgcgtcctacaaaggaacagta
gataagaaagctgaaaggtataaaataataggtaacaagattccacagcatgatcccact
atctcttctgaggaagaagaaaaacttagcagtgctgaaagtaatgaaatatttgatgac
caagagaaacaaattaaaatacccattaaaaaatctaaggaggttaaattagataaagct
aaggagaaagctaagaaaataatcaaaaaggatataacaaaaaaacctgatgtttcttac
aaagaaacagtagatgaaggagtagaaactagcagtgctgaaagtgatgaattagagatt
caagatgaatatgttaaaaaacctagcagtaaagtaaaagagcctaaattagacttaact
gtagagaaagtaaaacaaataaaaaagatccccactaaacaaccttttgttatatccaag
aaagcagctactgaaaaaatagaacttagcagtgctgagagtgttgagctactagaggct
ctagatgaacatgctgagaaaccttcaaaaaagatagaagaggctagagcagataaaatc
atagacaaaacaaaaaaagtttccaaaaaggtgccaataaaagagcctagtatgtctcca
gagaaaatagtatatgaaagaaaggaaataagtagtgttgaaagtcaggaatctttagag
gctcctgatgagttgttacgccacaaagctactaaaaaattaaaggaagctgaagttgct
cctgccagacccaaaattattactagagatacaaaaacagatatggtgaaaatattgcat
aaagatgaaaaggcagatttacaacgaggagaagagggaggtacatgggtagaaaaggta
gatgcagagttaggtaaaaaaatacctgataagaagggcattgaggatcttaagaaaaag
gagcatctcttcaaagatattgtacacaagaaagatataactgattcaaaaacacttaca
gatactataaaaactccaataacacattttgtaaatgcaaaagaagaaaaagtaacaggt
gtgcatgctgttatacccactgttgaaatatcaattgaagaaccacccagtgttgatgag
atatctttatacgattccgcaaagaagatagaacaggataaaaaagtatttggggaatca
aaggttacggtaggtgatatccttgagcagccaacagagaaagtgaaaaagattgcaaaa
tctgaaaaaaaggcacaccctcaagaatcacccacagagcctaaaaaagaaagtctttcg
ccattacaacaaattaggcgcttgaaaaccccaattgataaagacaaaatatcaataaaa
gtacaacctgaagagaaaaagcctgtgattccagtccttaaaaaagtagaaaagattaaa
actcctctacctgcagaagacgtttctctatccggcaaagggatctcaactaaagatgat
agatctttgaaagtgattagtagaaccagtactcctactgacagaagaaaggtagagcaa
aataaatctttaggcaaagagacacctcaagatgaaagctctttgaaagtgatcagcaga
actagcactcccattgataggagaaaagtagaacagaagaaatcctcagacaaagaaaca
cctcttttaaggagcccaataaaagataaggattctgcatctctgaaaacagaaacagat
tccaatgagatggaggaattagaagaagatgaaacctgggaacaagaactggaaagtaca
tctgaacatactgactatggctctgaagaagatatccttagtgaggacagtggacaagga
aggaaaagggccagagaaactccagcaaaggccattggtaggcgagatactaaaacacca
aaagatgaggctcctaggggtaaacttccacttaaaggtgtcaaaaagacaccttcgccg
ctagatgctgacaagaagaaacttcgccctggcagtggtggtgacaaacctccagatgaa
ccagcatttacataccagctgaaggccgtgccattgaagttcgtcaaagagttgaaggac
attgtgttacaagaagcagagtctgttggctcgtcagcaatttttgagtgccttatttca
ccctctactgctattacctcctggatgaaggatggcagcaacctgagagaaggccccaag
cataagttcatttctgatggcaaagacaggaaactccatattattgatgtgcagctttcg
gacactggagaatacacctgtgtagcaaaacttggcaacaaagagaagacatctacagcc
aaacttattgttgaagaattacctgttaaatttataaagactctggaagaagaagtcact
gttgtcaaaacacagcctttgtatttgagctgtgaactgaataaagacagggatgtggtc
tggacaaaggatggcaagaagcttagtgaggcttcacctggcagataccaaactaatatt
attggattaaaccgtactctgactattttggctgcggacgatgaagatgctggagtatac
acttgtactgtagaaaatgctgacatcaaatgttcctcaaatgtcaaagtagttgaggta
attcgtgactggttggtcaagcctattcgtgaccagcatgtcaagcccaaaaatacagca
acatttgtggcagatattgttaaagacacaccaaacatcaaatggttcaagggagacgag
gagattccattagaaccaaatgacaaaactgagctgaagaaagagggcaataaaatatat
ctgattatcaaaaatactggcccagaagatgtagcagaatattctgtagaggttgaaggg
aaacgtgtcacagcaaaactcactttgggtgagcgtgaagtcgaccttcttaagccaatt
gaagatgttgtaatttacgagaaggaatctgcttcctttgactgtgagatatctgaggca
gatattcccggagaatggaaactgaaaggagaaacgctgcggccatcacctacatgtgaa
gtcagggctgaagaaggaaagcgtttcctcaccctccataaagtcaaagttgaccaggct
ggagaagttctattccaagctttgaatgcagctacctctgctattcttactgtaaaagaa
atcgagctcgactttgctgttcctctgaaagatgttaccgttccagagaagcgccaggct
agatttgaatgtgctcttacccgagaagcaaatgtcatatggtcaaagggcccagatatt
atcaaggccggtgacaaatttgacattattgcagatggaaagaagcacatattagtcatt
aatgagtctgcttttgatgatgaaggagaatacactgcagaggttgatggcaaaaagaca
acagccaagctcacagttgaaggcatcagacttaaatttatttcaccacttaaagatcaa
accgttaaagagggagaaacagctcattttgactttgagctttctcatgagaatatgcca
gttacctggtacagaaatgataagaagcttcacacaagtaggaccattcttatctctgaa
gaaggcaagactcataagctggaaataagagaagtgacccttgatgacatctctcagatt
aaagtcgaagtcaaaggtctacatacatcagcaaacttaaaagtattagaggctgatcct
tacttcatcgtaaaactgcaagactacactgcagttgaaaaggatgacattactttggag
tgcgagcttagcaaagatgtaccagtgaaatggtttaaaaagggtgaagaaattaaggcc
tcaaagactgtaactatcaagactgaaggcaaacgcagaattctgaagattaagaaagtc
gaagaaaaggacaaaggagattacgaatgtgactgtggaacggacaaaactaaagcaagc
gtgaacattgaagcacgcatcattaaagtagagcgccccttgtacggagtggaggtgttt
gaaggtgaaacagctcgttttgaagtagaaatctcagaacccgacgttcatgcccaatgg
aaacttaagggagaagtattatctccatctccagactatgaaatgatagaagatggaaag
aaacacgtccttatcttgtataactgcaaactggacatgaccggggagatttcattccag
gctgccaatgccaaaaatgctgccaatctcaaagtgaaagaacttccactcatcttcatc
actccacttagtgacgtcaaggtgtatgaaaaggatgaagcaagatttgaatgtgagact
tcaagattgccaaagactttccgttggctgaaaggttcccaggaactcggggaagatgaa
aaatatgaacttgtagctgaaggcacaagacacgctctggtcctcaagtcagttgccttt
gaagatgaagctaagtacatgtttgaagcagaggacaagagaaccagtggcaaactcatc
attgaaggtattcgtcttgaatttgtgacaccacttaaagatgtgacagttaaagaacaa
gaaacggctgaattcacaattgagctatctcatgaaaacatccaagttagctggtttaag
aatgagcaacgtctacatcccagcaagctggtgtcaatgcatgatgagggcaaattccat
accattaagttcaaggatgtcacactggatgacacttcactaatcaaagttgaggctatg
ggaaaaagcagcgaggctaatttgactgtgcttgagggagacccatactttacaaccaaa
ctgtcagattacactgcagtagagaaagatgatgtggtcctgcactgcgaggtcagcaag
tccaaagcaccagttaaatggttcaaggatggacaggagataattccatctaaatctgta
gccattaaagctgatggaaagaaacgcattatcacaatcaagaaagcttcaaagaaagag
atcggggaatacagttgtgattgtggaactgataaaactattgccaagctgaacattgaa
gatcgtaatatcaaggttgtccgtcctctgtacagcgtggaggttatggaaacagacact
gcccgctttgaaactgagatatctgaagaagatgtccatgctaactggaaactcaaagga
gaagcattacattcttctcccgactgcgagatgaaggaagaaggcaaaaaacacttccta
atcctttacaatgtacgaatggaccaagctggtggtgtggatttccaagcagccaatgca
aaatccagtgcacatcttaaagtgaaagcccgcctaattggcctgctaaggcccctgaag
gatgtgattgtgacagctggggaatcagcaaccttcgactgtgagctctcctatgaaggg
atccctgtggagtggttcctcaaaggccaaaaacttgaatccagcgataagatcgtgaca
cgtgctgaaggaagagttcacacaattactctgagggatgtgcaattacaagatgctgga
gaagtcactctcactgcaaaagatttcaagacacaagccagcttgactgtaaaagaagct
ccagttgaattcactaaacctcttgaggaccaaacagtagaggaagaagccactgcagta
cttgagtgtgaagtgtccagagagaatgctgaggtgaaatggtttaagaatggacaagaa
atccataaaaccaaaaaatatgacatcatcactgaaggaagagttaggaagctcatcatc
catggctgcacacttgatgatgcaagaacatacacatgcgatgccaaagatttcaagaca
tctgcattcttgaacgtagaacctccatttgtggaatttagcaaacctcttactgacctt
gaagttaaggaaaaagaaactgcccggtttcagtgtgagatttctcgtgaatctgccaag
gtacgctggttcaaagacggagttgaaattcgaaagggcaagaaatatgatattatctct
aaaggagtcacacgcgccttagtggtgaataaatgtgtgtttgaggatgaagcagaatat
acctgtgaatcaaaaatggccaggacctcagggttgcttacagtcattgaggaagaagct
attttcaccaaaaatctacccaatattgaagcatgtgaatctgaatctgtcaaactggtc
tgtgaggtctccaaggctagtgctgaggtgtcctggtttaaaggagatgatgatctgccg
gatggtggaagatatgaacacattgccgaaggcagaaagaggatcttgatgatccacaat
atccgtttggatgatgccggcgaatacaactgtagactgccaaactcccatacaacaggc
aaacttggaatcaaagaacttgctgcagagtttgtttccagaccgcagaatcttgaagta
cttgagggtgaaaaggcagagtttgtctgctctgtttctaaagaagcttttgaagtacag
tgggttaggaatgatacaattcttgaagctggagataagtatgacatcatttctgatggc
cgaaagaggattttggttgttaaagatgcagtgccgaaagaagatgaaggaacctatgct
gccatgattggacagtccagggcaccagcagaattgaccgtaattgagaggctcaggatc
attactcctctaaaggaccaacaagtcaaagaaggacaagaacttgtctttaactgtgaa
gtcaatacagaaggggccaaagccaaatggttcaaaattgatgaagcaatatttgatagt
ccaaaatatattatggtacacaaagatctggtctatactcttagaatcagggatgctctg
ttggatgaccaagccaattactctgtgtcattgacaaaccacaggggtgaacatgtcaag
tctgctgcctctctaactgtcgtggaggaggacttgagaattgttgagcctattgaagat
attgaaacaatggagaagaagtcagtcacattctgctgcaaagttaaccgcccaaatgca
acagtcatgtggatgaaaaatggccaggaagttgttctggacagaagagtcctgtataag
gttgacaagtacaagcattctcttattattaaggactgtggatttgtggatgaaggcgaa
tacactgtcattgcgggacaagacagggcagtagctgagctcttgatcacagaagctcct
gcagattttgttcaacatctccaagaccaaactgttattgagtttgaggatgctgttttt
acgtgccagctctcaaaagaaaaggctgctgtgaaatggtatcgaaatggccgtgaactt
agagagaacaaaaagtatcaatttgaaaaagatggaagcctccacagacttattattaaa
gactgcagaccagaggatgaatgtgaatattcttgtggagttgatgagagaaaatcaaga
gcaagactttttgtcgaagaaatcccgattgagattatccgaccacctcttgatgtcttt
gaagcgccaggctctgatgtcatctttgaggctgagctaaataaagacagagtagaagtg
aaatggctgagaaacaacatgatcattgtccagggagacaaacatcaaatgatgagtgaa
ggaaagatccataggctacaagtttgtgaaattagaccccgtgatcagggcgaatacaga
tttgttgctaaggataaagatgctagagcaaaacttgagctaacagctgtaccaaagata
aagacagccgatcagaacattgtaatcgatgcaggaaagccacttacaatggctgtacca
tatgatgcctacccaaaagcagaagctgaatggcgtagaaaaggtgaaactttgtctgat
gtgcatgtggatactacagcaaatgcaacaagcttcaggattcctgaaacaaagaaagct
gacaaaggccattacacaatcatcctccagaacaaacatggcaaggcagaggcacacatc
aacctggatgttattgatgttcctgggcctgtcagaaatctagaggtaattgacacatat
gatggagaagtcagtctagcttgggaagaaccagagtcagatggtggtaccaaaattact
ggctatattgttgaaaggagagacataaagcgtaaaacttgggtccttgttactgaccac
gcagacagttgcgaatacactgtcactggactccagaaaggaggtgtagaatacttgttc
cgtgtcagtgccaaaaatagggttggtgctggtgaacctgtggaaacagataaacctgtt
gaagctaagagcaagtttgatgttcctggacctcctctcaatgtggccgtttgcaatgtc
aatcgctttggtgcatcactgacttgggagccaccagagtatgatggcggagctgaaata
acagcatacattattgagctgcgtgacagagcttccatcaaatgggacacaggcatgatt
accaagcctgatgaactgggagccactcttaatgatgttgtggagaacaaagaatacatt
tttagagtcagagctgaaaaccaagctggaattggcaaacccagtgctgctacacctgct
attaagatcagagatccaattgacaagccgagccctccaaataacctgactcatgcaaat
caaacaaagtcctctgttcagctcacatgggagcctcctcttcaggatggtggaagcccg
gtattaggctacattattgaacggtgtgaagaaggcaccgacaaatggatacgatgcaac
gtgagactggctcctgatcttacatacaaggtaactggtctgaaggcaggagcaaactat
ttgtacagagtctctgcagaaaatgcagctggcatatcagatcctacggaaagcttagga
cctcttacggcagatgatcctcaaacaccaccaactctggacttaagtgccttcaaaaag
ggcctggaagtaattgtccccgaacccctcaaaatacacgttccaatcacaggctatcct
actccaacagcagcatggtccgtgaatggcacagtcttggaaagcaatgaccgtgttaag
atagagaccactattgcctttgcagagcttgtcattgttccaagtgaacgttctgacaaa
ggaatctacacattagagctgacaaaccctgtaacatccatatctggagaaatttatgtg
aatgtgatcgctcggccaagtgctcctagagagctcaaggttggggatcttacaagaagc
tctgtcaatctttcctgggaagctcctgagaatgatggtggcagtcctcttactgggtac
cttattgagaaacgagaagtcaaccgcaagacttgggctagggttatggacaatgtaatc
gaccaagaattcaccgtttctgaccttatccaaggcaaagaatatctgttcagggtgtct
gcgtgtaacaagtgtggaccaggagaacctgcatacattgatgagccagtgaacttgtct
gcaccagcaactgttcctgacccacctgaaaatgttaaatggagagacccaacaggcaaa
ggaatcttcctcacttgggaaccacctaaatatgatggtggttcacgcattaaaggatac
attgtggagaaatgccatcgtggcacagacaaatgggaaatttgtggtgattctgttgta
gaaacaaagttccaagttgacaatcttacggaagggcagtggtatgcctatcgtgtaaag
gcacttaatagacttggcgccagtaaaccaagcaagccaaccgatgatattctagctaca
gatcctaaagaggccccagaaattttcctggatgttaaactgcttgctggtttaacagtg
aaggctggaaccaaaattgaactgcctgctgcaattaatggaaagccagagccaaagatt
acatggagcaaagcagatactcttttaagaattgacacaaggataaacattgaatccaaa
cctggacattctacagttatcattagtgagagtaaacggagtgactttggaacttacatt
attgaagccataaacacctctggccgagctacagcagttgttgaagttaatgttctagat
aaacctggacctccagctgcttttgatatttctgatataaccaatgaatcttgtgtgctg
acatggaatcctcctagggatgatggtggctctaagatcacaaactacatccttgaacag
aaagctggagacagtgaagtctggcacaaactgtcatcaaccattaaagaaacccggtat
aaggctacaaaactgacacctcttaaagaatacatattcagagtcagtgctgaaaacatg
tacggcattggggagccagtccagtcactttccatggtggccaaatattcatttgatcca
cctggtcaaccaactcgccttgaaccttctgacattactaaagatggagttacattgacc
tggaatgagccagatgaagatggtggaagtcccattactggatactgggttgaaagactg
gatccagaaacaggaaaatggatcagatgcaacaagactccagtgaaagatcctacatac
agagtcaaaggccttaccaacaaaaagaagtatcagttccgtgttctggctgaaaatctt
gccggccctggaaagccaagtaaagaaactgaaccaatcttaataaaagatccaattgat
ccaccgtgggcaccaggcaaaccaactgttaaagatgttgccaagacatctgcatttttg
aactggctcaaaccagagcatgatggtggtgccaaaattgagtcctatgttattgaactg
ctgaagacaggaacagatgaatgggtcagagtggcagagggtgtccctactacagaacac
tttttgaaaggccttatggagaagcaggagtattcatttagagtaagagctgtaaacaag
gctggagaaagtgaacctagtgaaccaagtgatccagtactttgcaaagagagactcaat
cctcctactccacctcgtttccttgaggttattaacataacaaagaatacagcagatctt
aaatggactccacctgaaagagatggtggctctccgatcaccaactacattgttgagaag
agagacgttaggcgcaagggctggcaaacagtagacaccactgtaaaagacaccaaatgt
tcagtgacccctctgtctgaaggctccctttatgtattccgtgttgcagctgaaaatgca
gttggacaaagtgactattgtgagctggaggactccgtgctggccaaagatacattcact
actcctggaccaccatatgcacttacagtgcaagatgtaacaaagagacatgtggaactg
aaatgggaggccccgaagaatgatggtggaagacctattcaaagatatgttattgagaaa
aaagagaagctggccacacgctgggtgaaggctggcagaactactggaccagagtgccat
ttcaaagtaacagatgttattgagggcacagaagttcagttccaagttcgtgcagagaat
gaagctggagttggtcatccaagtgaacctacagacatgttagccgttgaagacccaaca
agtcccccatcaccacctcttgagctacatgttactgatgccagtagagaccacattgcc
attgcttggaaggctccagaaaagaatggtggcagccctattattggataccatgttgaa
gcatgcccagtgggcactgagaagtggatgagaatcaattcacgaccaattaaggaccta
aaatacaaaaccgaagaaggcattatccctgataaagagtatgtgctccgtgtcagagct
gtcaatgctattggtgctagtgatccatctgaaatctcagagaatgtctttgctaaaaac
cctgactgtaacccaaccattgatctgaaaactcaggatattgttgtagtggaaggagaa
aaacttactatccctgtgccattcaaatctgtgcctgcaccaactatcaattggcataag
gatggaaaagaattcaaaatagctgacagagtttctgccaagagtgactacacctctgcc
actctagaggtttctaacattgttcatgctgatgctggagtctatactattacactggag
aataagataggctcaaccacaggatcaatcaatgttaaagtcataggcctacctggtcaa
tgtaaggatatcaaggcagttgatgttaccaagaattcatgcaaagtatcttgggagcct
ccagaatatgatggtggaagtcctatactacactatgttcttgaacgcagagaagctggg
cgaaggacttacacagcagtgatgtctggagagaacaaactaacatggaatgttaaagac
ctgatacctaatggagagtactactttagagtcaaagccgtaaataagattggtggagga
gaatatcttgaactcagaaaccccatcattgcagaagatgctaagcaacgcccagatcca
cctgttgatgttgatactcataatccaacttcaaagaccataaccctcacctggaaacct
cctcagtatgatggaggttgcaagatcatgggatacataattgagaagatacctaaaggt
ggtgaaaagtgggaaagatgcaatgactctcttgtacctgttctgtcttacactgtgaaa
ggtttggaagaaggaaaagaataccagtaccgtgtacgtgcagaaaatatagctggtgtc
agtgaaccttctcgtgtaactccagaaactaaagctgtagatcccatggatcctccaaaa
gtcttcctttcaggcagtttgcagtctggactttcagtcagacaaggagatgaaattact
ttggatgcacatatcactggttcaccatatccaacaattacatggcttagaaatgatgag
gtaataagacctgaagagataaagaaaagagtggacaaaatagtacctaggaggaaaaag
gaagcagttgtagatgagccattccacctcagcctgccagagcgcatgaacgttgacaac
agcagacaaggagaatctgagctgtcggtcagagactcaattcgtgaggattatggcata
ttcacaataaaggttgaaaatgaccatggtgttgccaaggcttcatgtgaagtaaatgta
ttagatttacctggacctcctgtgaattttaaatttgaagaagctaggaagaactctgtt
acatgtaattgggagcctccgctggatgatggtggtagtgaaatcatgaactatatctta
gagaagaaggacaattccaaggctgaaattggctgggtgactgtgacatctacactaaga
cactgtaaatatccagtcactaaactaattgaagacaaagaatacattttccgtgtatca
gctgaaaataaatttggctctggacctccatgtgtctctcagcctctccttgctaaagat
ccatttactcctccagatgcaccagaaaagcctgaaattgatgatgttactgccaacagt
atgctggttaaatggaaggaacccaaagacaatggaagtcccattttgggatactggatt
gagaaacgtgaaattaacagcactcactgggctcgtgttaacagaaacctgatcaatgcc
cttgaagcccgagctgatgggctttttgagggtcttacatacatatttagagtgtgtgca
gaaaatgcgggtggtgttggaaagttcagtgttccctctgatccaaagactgcacaagat
ccaatattgcttccaggacctccgattccaagagttatggacacaacttcatctgctatt
gaattagaatggaatcctcctctttataatggtggtggagagattactggctactttgtt
gacaaacaactcatgggcaccaatgaatggtcacgctgcacagataggccaattaaactc
ctcaaatacactgttaaaggcattagagagggggcagattacaaagttcgtgtgagtgct
gtaaatgcagctggagaagggcctccaggtgtaactgaacccataacagtgctagaacca
caagaaccacctattgttgaattagacctttcggtaaaagatggtatccagattcttgct
ggccaggatctaaggattcctgccactgtctttggacgccctgcacctaaaattaaatgg
actgtagaagatggagaactgaacaaagagaaagctgaaataattaatgagggcaactct
tctgtacttaccattccaagtgcagaaagaaaggaccatggaagatacattatcactgcc
agtaatgaaagtggtaccaaatctgctgcaacaagagttgaaatctttgatgtgcctgga
ccagtaactgagctaaaacctgtagtggttaacagaaaaatggctttacttaactggtct
gacccaattgatgatggtggcagtgacatcacaggcttcataattgaaagaaaggatgcc
aaaatgcacatctggagacagccaattgatacagagaggtctaagtgtgacattacaggt
cttctagaaggacaagaatatatgttccgtgtcatgtgtaaaaataagtttggctgtggt
ccacctgttgatttgggaccaattcttgctgttgacccacaaggtccacctggttcccca
gaaagattcacctacactgaaagaacaaagtcatctgttaccctggactggaaacctcct
cgtaatgatggtggcagccctattatagggtatattattgagaaacgacgacatgatgcc
acagagtttgaaagatgcaataaaaggcttgtaccagagacatcctttttagtagacaac
cttgcagaactgcacatgtatgaattccgtgccaaggctgtcaacgatattggtgaaagt
gaaccttctctgcctctcaatgtggttattcaagatgatgaagttccacctacaattact
ctccgcttgactgtcagaggtgataccattaaagttaaagcaggagaacctgtcaacatc
cctgcagaaatcactggtcttccaatgccaaagatcgaatggtctaaaaatgaggtggtt
attgaaaaagtaccaccatccatgaagattgcaaaacaagaagtttcaagaactgatgct
aaatcagaggttattattcctagtgcccagaggagtgataagggaacctacacaatcaca
gcttcaaaccgccttggagccataaaccgttctgtcaatgtggaggtctatgaccgtcct
tcaccaccaagaaacctgcaagtgactgacatcaaagctgaatcctgctacttgatttgg
gatgcaccattggataatggtggaagtgagattagcaattacattgttgataaacgagat
gcaagcaagaagaagtcagaatgggaagaggtttccaacattgtagttgacagaagatat
ggaatctggaagctcacaactgatggggaatatcagttccgtattagagcagtaaacaaa
tatggtatcagtgatgactgcctgtctgacaaggtggtaataaaggatccatttggcctt
cctggacctccaaagaaacctaaagttactgaccacacaagatcctctatgttggtatcc
tgggaacctccactggacaatggtggctctccaatcactggctattggctggagaagaga
gaagttggtggagtatactgggggcgtgtaaacagagcaccagtcactaaacctgctgtg
aaaggtctagaattcaatgtactgcgcttgattgaaggtgtggaataccaattcaaagtg
atggctatcaacgctgctggagtgggtcccccaagtgagccatcagaccctgctctggct
acagatccaatctttgctcctggagctccgtcttgcccagatgtgaaagacaaaaccaag
aacagtgtgtctctcgcctggaagaaaccagacaaagatggtggcagtccaattaagggt
tacctagttgaaatgcaagaagaaggcagctctgaatggaagaaggtcaatgaacctgac
aagctcttccccacttgtgattgtgtggtccccaacctccaagaactcaagaagtacaga
ttcagagttaaggcagttaatgctgctggtgaatctgagcccagtcttgcaactggagaa
atacctgtaaaggaaattcaagaggagccagatatctcaatcgatctaaaggcacaagac
tatttgaactgtcgtgctggtagccaaatcaaaatttctgctgttatcaaaggccgccct
gtgcctaaaacatcctgggagtttgatggagtggcaccgaaagaaataaaggatcaagtc
cacaatcttccagttgattcacaagttgaagcaactgacacaacttcagttatcatcatt
cctaaatgtaacagaggacactctggaaaatacaccattacagccaaaaacaaggctggg
cagaaaactgtcaacgtcagggtcaatgttctggatgctcctggaccaccaaaggatcta
aaagttggtgatgtcactagatctacagctaaacttacatggaaagccccagataatgat
ggtggagacaggattaagaactacataattgaaaagaagacagtggaagcaaaatcatgg
agcaaggttgctaatgactgtgcaggaacctcatttactgtacctgaccttattgatgga
caggaatatttcttccgggttacagcagaaaatagatttggcactggacctccaatttca
actattcagagaacaagagcacgagatccaatccatccacctgaaccaccgactagacta
aaggttggtcttgtaacaaagaattctgtggcactaacttggaggccaccaaagaatgat
ggtggggcacctgtaacccattatataatagaacgcttagtttgggatcccagtggagaa
ggcaaagagacctggaagcagtgtaacaaacgggatgtagaagaaacaaaattcattgtt
gaagacctaaaggagggtggagaatatgagttccgtgtcagagctgtgaatgaggctgga
cacagcaaaccatcttcaactgttggcccagtagctgtaaaagatcagacatgtcctcct
tcgattgagcttaaagaatttatggaagctgaagaaggaactgatatcaacattctggcc
aagattaagggttgtccattccctacactgaaatggtacaaagcacctccaaacaagcca
gatgacaaaacaccagtgcagtatgaccaacatgttaacaaagttgttggtgaaaatgac
tgcacattggtaattcatcagtcccatagaagagatacagccttatacaccctgacagct
gaaaacaatctgggagctgattccaaggaaatgcgattgaatgttctagggcgcccagga
ccaccagagggaccaattaaatttgaagcaataacagcagaaaacatgacattggcttgg
cttccgccaaaagatgatggaggctctaagattacaaattatattattgagaagagagaa
gcaaataggaaaatttggtcccctgtaactaaagaagctaaggaatgcatctacacaata
ccaaaactaatcgagggtcatgaatatgtgttccgtattatggcacagaacaagtatggt
gttggacttccacttgacagtgagcccgaaaccgcaagaaacctgtattctgttcctgga
cagtgtgaaaagccatcagtcagtagtgtttcacgagattctatgactgtcaactgggaa
gagcctgaatatgatggtggctcacctgtgacaggctactggctggaacttaaagagact
acaggaaagagatggaaaagagcaaaccgtgatccaatcaagattatgacactgggagtt
tcttacaaagttacaggactcattgaaggatgtgattatcagtatcgtgtgatggctatt
aatgcagctggagttgggcctccaagtctgccatctgatccagcaactgcaagagaccca
atatctccacctggaccaccatttccaaaggttactgactggacaaagtctactgctgat
ctagaatgggttccaccctctaaagatggtgggtctccaattacaggatattttgtggag
tacaaggaagagggaaaggaggagtgggaaaaggctaaagataaagaaatcagaggaaca
aagtttgttgtacctggactgaaagaaggaagcttttataggttccgagtaagagcagtt
aatgctgctggtgtcggggaaccaggtgatgtcacagatcttattgaggccaaagacaga
acagttctacctgacattcaacttgatgccagtgtaaaagagagaattgttgtccatgct
ggtggagttattcgaatcatagcttatgtttctggaaaaccagctccagaaatcatttgg
aacagagatgaaaaagctttgccccaagaggctactattgaaacaacagctattagttca
tctttggtcattaagaaatgtcagaggagtcaccaaggcatgtacactctggttgccaag
aatgctggtggggaaagaaggaaaaccattattgttgatgtattagatgttcctggacca
gttagccagccattccagactgaaaatctgacaaatgactcctgcaagctgacatggttc
tctcctgaagatgatggaggctcaacaataactaattatattattgagaaacgggaagca
gatcgcagaggatggactcccgtgacctacactgtaacaagacaaaatgcagtagtgcaa
ggacttatagaaggagtggcttacttcttccgtattgcacctgaaaatattattggcatg
ggtccatttgttgagactccgcgggaaattgttataaaagaaccaatatctgtgcctgag
cgtcctgaagatcttcaagtaactgcagttacaaaagattcaataagcctaagctggaat
ccacccaaatacaatggtggatctgatatcacaatgtatatactagagtgccgtctcatt
ggcaaagacaagttccttagagccacaaaagaaaagctgatgggcaggaaatatgaccat
gaaggattgaaggaaggtgacacatatgaataccgtgtcagtgcttgcaacattgttgga
caaggcaaaccgtccttctgcactaagccaattacttgcaaagatgaactagctccacca
acaattgagcttgattttagagataaactaattgtaagagttggagaagcatttgcaatg
attggtcggtatacaggcaaaccagctcctaaggttacttggttgaaggatgaaataaca
gttaaggaagatgatcgcacaaagatcaagaccactaaaaacacactctgcttgggtatt
cttaaatctgtaagagaagattctggcaaatattgtgtgcttgttgaaaacagcactggt
gcaagaaagggactgtgtgaagtgactgttgttgatcgtccacaaccaccagttggacct
gtgatttttgatgaggttcataaagaccatatggttgtttcatggaagcctcctcttgat
gatggtggtagtgcaattaccaactatgtagttgaaaagagagacactaacagagacctc
tggatgcctgtaacctcagcaaccaccaaaactacttgcaaggttcccaaactgattgaa
gggagagaatacataattcgcatctgtgcagaaaatctgtatggcatcagtgatcctcta
ttgtctgatgaaatgaaggccaaagatcgcttcagagttccagaggcacccgagcaacca
cttgttaaggaaattactaaagattctgctctggttttatggaaccgaccccgtgatggt
ggaaaacctatatttgcctacattgtggaaaagaaagaaactatggccaacaggtggtca
aaagtctcaagagagcctatctatccagacacacaattcagagtaacagaccttctacag
ggatgtgaatatgaattcagagtatcagcacagaatgaaattggtattggtgatccaagt
ccaccatccaaaccagtatttgccaatgatccaatagtcaaaccaagcccaccagtcaac
ccagaagctgttgacaagaccaaaaattcagttgatttgtcctggcaccctccaaggcac
gatggtggaggcaagataatcggttaccttgttgaatatcaaaaggttggtgaggaagaa
tggaagaagtccaaccatgcccctgatagctgtcctgatacaaaacataaagtagtggga
ctcacagaaggtgatacgtacaaatttagaatcaaagcagtgaattctgctggtgaatct
gaacctgctgatgtccgagacccagtgcaagttaaagacagacttgaacctcctgagctt
ataattgatgctaacatggcacgagaacagctagttaaagctggaaacactattgcactc
agtgctgtaatcaaaggcatgcctttccccaaagtcacctggaagaaggcagacaaagaa
attcctacaaaggctgatgttgtggtcacacctgtgggaagcaagcttgaaatccgcaac
tgtgtcaaggaagatgcaggagtttattctctcacagtagaaaatgaagcaggctctaaa
accgttgaagtaaaagtcactgtgcttgataaacctgatccaccaagagatctagtagtt
agtgaaattaggaaagattcttgctatcttacctggaaagaacccgaggataatggtggc
tcagttatcaccaattatgttgttgaaaagcgtgatgttgccaatccacgctggatacct
atctcaactacatctaagaaacacagtattatggccaggcacctgatggaaggcacacaa
tatttgttcagagttgctgcagaaaaccaatatggacgaagctcttacattgaaacacca
aaaccaatgaaggccatcgatccaatttatccacctgggccaccaaagaaccttcatcat
gtagatgtagacaagactgaggtatctcttgcttggaactatccagaccgtgatggtggt
tctgagatcactggatttgtggttgactatcaggaagatggtgcagaggactggatcaac
ttcaagactgtttctatacctgaatgtcttgtcactggtctgaaaaatggaaaggtatac
aaattccgtgtaagagctcaaaatattgctggactgggccggccagacacaactgtacca
atagagtgtcaagaaaaactggctgctccaaccattgaagttgatgtcaaattaattgaa
ggtcttgtagtcaaagctggtacaactgtaagacttcctgccatcattaggggaatcccc
attccaactgcaaaatgggtgactgacagtgctgaaatcaaatcagaaggcagctacaaa
attgacactgacagtttttcaactgtgctcactattaaggactgtacacgaaaagataca
ggagaatatttgctgacagtttcaaatgttgctggaagcaagacagtagctctgcaccta
acagttttggatgtccctggcccacccacaggtccattaaatatcctggaggttacacca
gaatacatggttatctcctggaggccaccaaaggatgatggtggaagtgcagtaatgaac
tatattgttgaaaaatgtgaaggcaagaaagaaacatggggaatagttagctctggaagc
actcagactaaagctaagattccacgactccagaaaggttatgaatatactttccgtgtc
agtgctgaaaataagatgggtattggtaaacccctagagtcaaaaccaactgttgccaaa
catatatttgacccaccatctccaccaggaaagccagtggtttctgacatcactgaaaat
tctgcaacagtctcctggactattcctaaatctgacggtggcagtccaattagtggctat
attgttgaaagaagagaactatctggtaaatgggtcagagtaaacaagactccagtgctc
gatcttcggttccgtgccactggtctatatgaaggcaacacctatgaatttagagttttc
gcagaaaatattgctggactaagtaaaccatctccagtatctgatccaataaaagcttct
cgccctataactccaccaggcccacccataaatcccaaacttaaagacaagagcagagaa
actgctgacttggtatggacaaaaccaaccagagatggaggcagccccattttaggatat
gttgtggagtgtcaaaaatcaggaacagcccagtggaatagaattaacacagatgatcta
attaaacaatgtgctttcagggttccaggtctgattgaaggaaatgaatatagattccgc
ataaaagcagcaaatatagtaggtgaaggtgaacctagagaactaccggaatctgttatt
gccaaggacattcttcacccacctgaagttgatcttgacttgacttgtcgtgatttactg
actgtaagagttggccaaacaatcaacattactgcccgtgtcaagggcagacctgaccca
gacattacctggtctaaggatagtaaagtagtcactaaagataataggactgaaatgact
caagatttccctccagttggcttgcagataaaaccggcaactagggcagatcatggtaaa
tatacacttgtggcgaagaacagcagtggtcaagctcagggtgtggttattgtcaatgta
cttgacagacctggaccttgtcagaaccttaaaattagctatgttaccaaagattcttgc
atggttgcctgggaaaacccacaagataatggtggctcagagataacaaactatattgta
gaataccgtgaaccaagtaaaagaggatggtatgtcatctcttctgatcttacaaagagg
ttgataaaagcatctcttatagaacaccatgaatatttctttagagtttgtgcagaaaac
aaagttggtcctggtccagttactgaaacgaagacaccaatcctggccattaatccagtt
gataaacctggtgaacctgagaaccttcacattgctgaagtaggcaagacatttgtgttc
ttgaaatggagacgaccagattatgatggcggcagtccgaatctatcataccatgttgaa
agaaaactgaaagattctgatgaatgggaaagagtccataagggtagcatcaaagaaacg
tcttaccttatagacagatgcagtgaaaaccagttataccagtttagagttcagactaag
aatgaaggaggtgaaagcaactgggtaaagacagctgaagttttggtgaaagaagaatta
ttgaaacctgcactagatctgaaattaactggaatgctagttgtgaaagcgggagaaaca
attagaattgaagctggagttcgaggaaaaccacagccagagattgcttgggcaaaggac
aaagataccacagatattgcaaaatcacctaggctgaaaattgaaaatggatcagattac
accaaatttatccttgagaagtctaggcgatctgacagtggaaaatttgttgtcacagcc
acaaaccctgctggaagctttacagctcatgcttctgtaaatgttcttgatgtgccagga
gaagtaagaaatcttaaagtttctgatgtatcaattgacagatgtagactcagctgggat
gaaccagaagatgatggtggatgtgagatacaaaactatattttggagaaatgtgagagc
aagcgaatggtttggtctacatactctgcttctgtgattctcactcatgcacaagtcact
cgtctgatagaaggaaatgaatatatcttcagagtgcgtgctgaaaataaattgggtact
ggtccacccacagaaaccaaaccaattgttgctaaaaccaaatacaatagacctggacct
ccagagcctccagaggttaccaaagtgagtaaagaagaaatgacagttgtctggaatcca
ccagaatatgatggtggcaagtctattactggatatattctagaaaagaaagaaaagaga
tcaatgagatgggttgctgcaactaagagtgcaattccagaaagacgtctgaaagtccca
aatcttatcccaggacatgaataccaattccgtgtaaaagcagaaaatgaaattggtctg
ggagatccaagtggaccatcaagacctgtagttgcaaaagacccaatagaacctcctggt
cctccaagcaatctaaaggtggctgatagtaccaggacctccattactctaggatgggga
aaacctgtttatgatggcggtgctccaatcattggatatgttgtagaaatgaggcctaaa
actgaagttaaggacaaggatcctgaggccggatggaagagacttaatgttgctgctcag
ttgatccacacacagtttactgtcaccacccttgatgaaaagcaagaatatgagtttaga
gtttctgcacagaaccaagttggcattggaaggcctgctgaactgaaagaggctgtgtca
cctaaagaaatacttgaatcacctgaaattgaactggatgccagtatgagaaagttggtc
actgttagagcaggttgtcctatcagactgtttgctatggtgagaggaagaccatcacct
aaagttacatggagaagaatgggaattgataatgttgtcaggaaaggacaagttgacatt
cttgataccatggctttcttagtaatccaaaactccacacgtgatgattcaggcaaatat
tctttgtcacttgtcaacgttgctggagaaaaagcagtgtttgtcaacgtcagggtacta
gacactcctggacctgtggctgaatttacagtctcagatatcacaaaaatgtcatgtcag
ctctcatgggtacctccagaaaatgatggtggaagccctgtgacacactacatcttagaa
aggcgtgaagtggacagaaagacatgggcaaaagtggtggcagactggaaaaagactagt
tttaaggttgctaaccttgtacctggaactgaatacttcttccgagttacagctatcaat
gaatatggctcaggcgttccaagagacactcctaaaggtgtacttgcaacagatccaata
agtgagccagatccacccaagaagcttgatgttacagaaattacaaagaacagtgccaca
ctggcatggcttccacccctgcgtgatggtggtgccaagatcgatggctatatcattagc
taccaagccgaaggacagtctcaggataactggacccaatattctgttgtaaaagatcta
aatattgtagttgttggacttaaagaaggcacaaaatacaaattcagggtggcagccagg
aactctgttggtgtgagcttgccaagagaagctgaaggaatatttgagattaaagaacag
cttttgccaccaaagatcttgatgcctgatcagatcagcatcaaagcggggcagaaatta
agaattgaagcccatgtttatggaaaaccagcacctgttttcaaatggatgaaggcagat
gttgatgttatgccatcaagtcgtttggctgtacataaaggaaagaattccactgtgctt
ataataaaagatgtgacaaggaaagacagtggatattactcattatctgcagaaaacagc
tctggtgttgccagtcacaggattcgtgtagtcgttatggacatcccaggtccaccagaa
cctccatttgagatttcagatatagattctgatgcatgcacactttcatggcacttacct
cttgaagatggtggtagcaacattaccaactatgtagttgaaaagtgtgatgtaagcaag
ggagactggattacagctgttacatcagttaccaaaactagctgccgtgtcggaaaactc
atcccaggacaagagttcatcttcagggtccgtgctgagaaccgctttggagtatcagaa
ccaattacatctaatcgtgttgttgctaaatatccatttgatgttcccagcgaaccaaag
aatgcccatgttaccaaggttaataaagactgtatatttgttgcatgggatagacctgat
aatgatggaggaagccccattacaggctatgctatagaacgtaaggaaagaaatagccta
ctgtgggtgaaggccaatgatactgcagtgcgctcaacagaatatccatgtgttggcatg
attgaaggcttagagtacactttcagaatctctgcactaaatagagctggaagtagtaaa
cccagcaagcccactgagtatgtcactgcaagaacacctgttgatccacctggaaaacct
gaagttattgatatcacaaggagcactgtgtcccttgtatggacaagaccaaagcatgat
ggtggcagtaaaattgtgggctaccttgtggaagcttgcaaacttcctggtgaaaagtgg
gtgaagtgcaacactgctgcttctcaagtcccaacagaagaatttattgttactgaattg
gaggagaatgagagataccagttcagagcaattgccaagaccagcatcaacatcagcaga
ccatctgaaccatcagatccagttgtcattcaggcagaaaatgttccacccaagatcgat
ctcagtatacagatgaaatccctgatcacagtcaaagcaggagcaaatgtatgtcttgat
gctcaagtatttggtaagcccatgccaacagtcgcctggatgaaggatggtgaagttgta
aaacctgctgagggtgttaaaatatcatctaagaggaacctcttccttctggaattgttc
agtgttaaccgcaaggaaacaggagaatatactattgtggctgaaaatgccagtggctcc
aaatctgcaactatcaagctcaaagtcctagataaacctggacctcctgcttctgttaaa
ataaatcatatgtatactgatcgggccatgcttagttgggagcctccacttgaagatggg
ggttctgatattacaaactatgtcattgacaagcgtgaaaccagtcgtcccaactgggca
caagtgactgctaatgtgcaaaccaccagttgcagtgtggagaagttgattgaaggacat
gagtatcaattccgcatttgtgctgaaaacaaatatggtgttggagatcccatcctaact
gaatctgtgattgctaagaacccatatgatgcacctggacaatgtgatccgccagtaata
agtaacattacaaaggatcacatgactgtaagctggaaagcaccagctgatgatggtgga
tccccaattactggatatttgcttgaaaagcgtgacacaaagtctttcaattggaccaag
gtaaccaaaacaccggtaatggatagaacagtaaaagcaacaggacttcaagaaggtact
gagtatgagtacagagtgactgccttgaacaaagccggaccaggcaaacctagcaactca
tcaagggcagtaattgctatggatccccagtatccacctggaccacctgcttttcccaag
gtggttgatacaacccgtagcagcataagcctgtcctggagtaaaccagcttatgatggt
ggcagccctattattggttacctggttgaagttaaacgaggagatacagataactgggtg
cgatgcaacttgcccaaaaacctgcatgatacccgctacactgttacaggcctgatggaa
agcaccgaataccagttccgtgtctcagcagtaaataaaattggttacagtgatcccagc
gaaattccagagaagcatactgctaaagatatcttaattgcgcccgaaggagagcttgat
gctgaattgaggaaagctcttgtgctccgtgctggtgttacaatgaggatttatgtacct
gttagaggacgcccagctccaaagatatcttggtctaaactgaatgcaaacattaaagag
aggcagggacttgatatcaagactacagaccatgacacctttctgcgttgtgaaaatgtc
aacaagtatgatgctggcaaatatatcttgacactagagaacagcagcggtgtgaagtct
tatactattgttgtgaaagtacttgatactcctggaccacctgtaaacctcataatcaag
gacagctccaaggactcagctatgatctcatgggatcctccaattattgatggtggcagt
ccaatcaagaattatattgttgaaaaacgtgatgcagaaagaaaggcttggtctacagta
tcaactgactgtcctaaaacatcatttagaattactaaccttgaggaaggcaaggcctac
tttttcagagtattagcagaaaatgaatatggcattggtgaaccatgtgaaactcatgat
gctgtgaaagcttctgaaaaacctggaccagttatagatctgaaagcactggctgtgtca
aaatcatcatgcactattgcatggaagaaaccaataagtgatgggggaagtcgtatcatt
ggatatgttgtggaacatttaatctctcaggacaagtggaaagacataatgagatccaaa
aaccttcagtatacaatgaaagatctcactgaagggaaggagtacacctttagagtgatt
gcccaaaatgattctggttttagttctccaactgacatttcaattgttgccaaggatgat
gttgttgcaccaaatgtggacttaaaggatctgccagatttgtgctacattgccaaggag
ggaagcactttccgacttaaaattccagtcagtggaaagcctgcacctacaattacatgg
aggaaaagtgaagacaaggttttgacagacagtggtagagtaactgttgagtctactgct
gtaaatactacgctgacagttcgtgagtgccagaaagatgatgcctcaaaatacacaatc
actttgaagaatccagctggcaccaaggaatctaccatctttataaaagtagtgggaaaa
cctggtattccaacaggtccagttaagtttgatgaagtgactgcagatgctatcacgctg
atctgggctcctccaaaagatgatggaggttctgaaattacaaactatatcctggaaaag
agagactctgtgacaaataagtgggtaacatgtgcttctgctgtacagaagacatcattc
agagttaccagactccatgaaggaactgaatacattttcaaagtcagtgcagaaaataaa
tatggagttggcgatggccttaaatcagattcagttgtggcaaggcatccatttgatgta
ccagatgctcctccaccaccaaagattgttacaataaggcacgatgctgcaaacctgact
tgggttgatccaaggaagactggtggttcaccaatcacaggctattatattgaagtgaaa
gaaagaaacagcctgctttggaagagagccagtaccactccactgagaatgaaggactac
agagttacaggtttagctgaaggcctagaatatgaatttagagttatggctcttaatctt
gctggagttgggaagccaagtcttccatctgagtcagttgtagctcttgatccaatagat
cctcctggcaaacccgaggtaatcagtgtcactaggagttcagcaactcttatctggaca
gaaccaaaatatgatggtggacacaagctggttggatacattgttgagaaacgtgatata
ccagcaaagagctggatgaaggccaatcatgtaaatgttcaggaatgtgcatttactatt
aatgatctaatagaaggtggaaaatatgaattcagaataagagctaagaacactgctggt
gctatcagccccccatcagagacaactggaactgttgtttgtaaggaagaatatgaggca
cccacaattgttattgatgcagctgtcaaagaaggtttaacagttaaagcaggagataca
attgtcatgacggcaacaaggattcttggcaaaccacctccaacctctgtgtggtccaaa
gcaggaaaggactttaagccatctgatattgtgcagatagaaacaggtccaacatcatct
accctgtctgttaaatatgcatcacgtaaagattctggagagtatacaataacagccagc
aatccttttggcacaaaagaagagcatgtgcatgtcaaagttctagatgtccctggtcct
ccaggaccaattgaagccagcaatgtatctgcagaaaaagctacactcaactggactcag
cctgctgaagatggaggttcaccaataacctcgtacactcttgaaaagagagaaaccagt
cgtttgctttggaccctggtggctgaaaatattcagtcatgtagacatgttgtcagcaaa
ttgatccagggaaatgaatatatcttccgtgtatctgctgttaatcactttggtgtaggt
gaacctgtacaatctgagccagtgaagatggtggacagatttggtcctcctggtcctcct
ggaaaaccagaagtaacaaatgtaaccaaagacacaataaccatagcttggaagcgcccg
gctgatgatggtggtagtgaaatcacaggttactttgttgagagaaaagaaaagaaggga
ttgagatgggtgagagcatcaaagaaacctgtttctgacctcagacttaaagtgactgga
ctcgcagaaggcaatgagtatgaattccgagtaagcgcagaaaataaagctggactagga
ccaccaagtgattcttctctaccagccttaaccaaagatattgcatatcccccaggtcca
ccctctaatccaaaagtcattgacacaacaaagtctactgcaacactgcactggggcaag
ccacattatgatggtggtcttgacataactggctacattgtagaacaccaaaaggaaggt
gaagaagaatgggtgaaagacactacaggaacagcacttagaatcactgaatttgtagtg
gcaaacctccagcctggtgcaaaatataagtttagaatccgcgcaattaatgctgcagga
actggtgaaccagcacaaattgatgacgttgaaattaaggatcgtgaagaaactccagat
tttgagcttgatgctgagctaagaagaactcttgttgttagagctggactaagcattcgt
atttttgtgccaattaaaggaagacccacacctgaagtcacatggatgaaaggtgacgtt
ccactgaagataagagccaacattgagaatacagagtcatattctctgctaatccttaca
gagtgcaaccgatatgatgctggaaaatacaccatgacacttgaaaatgcagctggaaag
aaatctggatttgtcaatgtcaaagttttagattcaccaggacctccactgaacctaaaa
gcaagagatgttacaaaagacagcatcaccttgcagtgggatatgccactcatagatggt
ggatcacgcattacaaattacatagttgaaaaacgggaatctacaagaaaggcttattca
acaataacaactaactgccagaagtgctctttaaggattcctaatttggcagaaggatgt
gaatactacttcagagtactggcagagaatgagtttggcattggtgagcctgctgaaacg
gctgatccaatacgagcaacggaagcaccttctcctcctgaaagcctaaatatcatggac
attaccaagaacagtgtaagccttgcttggccaaaaccagaacatgatggtggcagcaag
attacaggttatgtaattgaagcacagaggaaaggttctgatcaatggacacatattgca
atagtaaaaacactggactatttagtgaaaaacctaaatgaaaatgaagaatatgtgttc
caagtgatggctgtcaacagtgcagggagaagtgatccaagggaaagtagaccagttatt
gttagagaacagcagatgcttccagagtttgacttacgtggcatctatcaaaagactgtc
cttgccagagctggtgataatattaaagttgaaatcccagttcttggaagaccgaagccc
actgtgacatggaaaaagggtgatcagcttcttaaagaaactcagagagttaatgtggaa
agaacagcaactgccactatcttaaatatcaatgaatgcacaagaaccgatgctggaaaa
tatactttggcagctaaaaacattgttggtgaaataagtgatgtaattactgtccaagta
catgatattcctgggataccaacaggaccaaccaagtttgatgaaatttcatcagacttt
attactttatcctgggacccccctgagaatgatggtggtgttccaataagcaactatatt
gtggaaatgcgagaaaccaacagcacatcttggactgaactggcctctactgtaatacgc
acaacatttaaagccacaaaattaacaacaggattggaatatcaattccgtgttaaggca
caaaacagatatggaactggcccagctctcaactcagaagctgttgttgctgcttatcca
tttagggttcctggacccccaggcacacctcaagttattgctgttacaaaggattcaatg
actatcagctggaatgaacctgttgctgatggtggaagtccaatcttaggctaccatatt
gaaagaaaggaaagaaacagcattctgtggcagacaatcagcaagacactatttttagga
aatatctataaatcatcaggtctaacagatggcattgcctatgaattccgcacagtagct
gaaaacatggctggcaaaagtaaaccaagcaagtcttctgaaccaacatttgccttggat
ccaattgatccaccaggtaaaccagttgccctaaatattacgagacactcagtgactcta
cagtggacaaaaccagaatataatggtggctttaagatcactggctatacagttgagaaa
agagatcttcctaatggccgatggctgaaggctaactttggtaacattctagaaactgag
tttactgttagtggattaactgaaaacacagagtatgagtttagaataattgccagaaat
gcagctggtgctgttagccaaccatctgaaccgtctgatgcaataacatgcagagatgat
atagaagagccaagaataatggttgatgcaaagtttaaggatgtcatcattcttaaggct
ggtgagattttcagactggatgctgatgtttctggacgtcctattccactgctgacatgg
acaaaagaaggaaaggaccttgaagacacatctaaattagaactaaaaatagcagatttc
tccactgctttgataaacaaagactctgcaagaaaagatggtggtgcatacacacttaca
gcttctaaccctggaggatttgctaaacatgtatttaatgttaaagttcttgataggcca
ggcccatgtgaaggtccactggctgtatctgaagttacttctgaaaaatgtgtgttgtca
tggttgccaccgctggatgatggaggtgccaagatagatcactacattgtagaaaagcgt
gaaaccagcagattggcttggacaaatgtggcaccagatatccaagtaacaaaattcaag
gttacaaaactgctgaaaggaaatgaatatattttccgtgttatggctgtcaacaagtat
ggagttggagaaattttggaatcagtacccactcttgcagttaatccatatgtaccgcct
gatccacccaaaaccccagaagtaacaacaatcacaaaagactctatgattgtttgctgg
ggacatccggactctgatggaggtagtccaattacaaactatgtggttgaacgccgtgac
aaggcaggactccgttgggttaagtgtaataaaagaatcctcactgatttgagatacaaa
gcttctgggctcacagaaggccatgagtatgaatttagagcagtggctgaaaatgcagct
ggaataagtaaaccaagccagtgcagtccatactacaaggcatgtgacacagtgttcaag
cctggacctcctggaaacccaagagttctagacacaagcagatcatccattacaattgct
tggaacaaaccagtttatgatggaggttcagaaataactggctacaatgtggaaatatct
ttacctgaggaagatgaatggaaagttgtcacaccaccagctggacttaaagctacttcc
tttactattacaggtcttaaagagaaccaagaatataaaatccagatatatgctctgaac
tcagaaggagctggagagtctgctcttgtcccaggatcaccaaaggctgaagatagaatg
cttccacctgagattgaattagatgctgaacttcgcaaagtcattagcattagagcttgc
tgcacattacgtttgtttgtaccaattaaaggaagacctgctccagaagttaagtggaat
agagaaaatggtgagcacatagaaagagcatccattgaatcaactagttcctatactcta
ctagttgtggaaaatgtaaacaggtttgatagtggaaagtatatgctgacagtagaaaac
agctctggaagtaaatcagcctttgtgaatgtcagagtgctggatactccaggagcacca
caagatcttaagataaaagaaatcacaaaatcatctgttacattgacatgggagcctccg
ctcattgatggtggatctaagattaagaactacattgtggagaaacgtgagtcaaccaga
aaggcatattcaacagtaacagctaactgtcataaaactagctggaaaattgacgcgtta
caagaaggttgcaactactactttagagtccttgcagaaaatgaatatggaattgggtta
cctgttgaaacatcagactcggtaaaagtatctgaaagaccacttccaccaggaaagatt
agtttggatgacgtaacaagaaatagcatttctctgtcttgggaaaaaccagaacatgat
ggtggaagcagaattatgggctacattgtagagatgcaaagtaagggtagtgagaagtgg
acaacatgtgcaactgtgaaaacaacagaaaccaagataactggactgatacaaggggaa
gaatacatgttccgtgtatcagctcaaaatgaaaaaggaattagtgatccacgacagctt
ggagttccagtagttgctaaagaccttgtgattgcaccagctgttaagcttcagtttaat
acattcagtgttttagcaggagaagaccttaaagttgaagtgccatttgtggcacgtcct
aagccaacagttgcatggcacaaagatagtctaccactgaaacaaacaactcgggttaat
gcagaacatacaggcagcatctccttgctcacaattaaagaggcatctaaagaggatgtt
ggccagtatacagtcaaacttgccaatactgcaggagaggcctcagaacagctcagaatt
attgttctcgacaagccagaacctccaacaggtccagttaaaattgatgaagtcacagct
gacaatattagcatatcttgggagcctcccaaatatgatgggggaagttctatcaataat
tacattgtagaaaaacgtgacacatcaacaacagtttggcaaattgtgtctgctactgta
gcaagaactactataaaggcaacaagactcaaaacaggaagtgaatatcagttcagaata
gctgctgagaacagatatggaaagagtggatacttggtatctgcagcggtagtagctcaa
tatccatacaaattgcctggaccacctggtacaccatttgtaacttcagtttctaaggac
agcatggttgtacaatggaatgaaccagtaaatgatggtggcagcaagatccttggatac
catgtagaaagcaaagaaagaaacagtatcctgtgggtaaaaatgaacaaaacaatcctc
ccagacactaaaattaagacaaccaatgttgaggaaggtattgaatatgaattcagagtt
tatgctgagaacattgttggaattggcaagccaagcaaaatatctgaatgctatgtggca
cgagacccatgtgatcctcctggacgtccagaggctttagttgtcacaagaaattcagtc
acaatccagtggacaaagccagagtatgatggtggtagcaaaatcacaggttacatcatt
gagaaaaaggaactacccgaaggacgctggatgaaggccagcttcacaaatgttattgaa
actctgtttgcagttacaggactagttgaagatcaaatatatgaattccgtgtaattgca
agaaatgcagctggaattttcagtgaaccttctgaaagcactgggccaattacagcaaga
gatgaggtagagccacctcgtgtgagcatggatcccaaatacaaggaacttataacaata
aatgctggtgaaatgtttaagattgaagcagatgtccatggcaagccaataccatctgtt
caatggttcaaggcaggagaagaacttgtaaacacagctcgtctagaaattaaaggcact
gatttctttacgtctctaagtgtaaaagaagcgattagagtggacagtggtcagtacatt
ttgctactgaagaatgttggaggtgaaaaatctgtatctgttaatgttaaggttcttgac
cgaccaggacctcctgaaggaccgatcactatctctggtgttacagctgagaaatgctca
ttagcatggaaacctccaaagcaggatggtggcagtgatattgaccactatgttgtagaa
agaagagaaaccagtcgcttagtatggacagttgttgattcaaatgttcaaactcttagt
tgcaaagtaaccaaatttttagaaggaaatgaatacatcttccgtataatggctgtaaac
aaatatggtgttggtgaaccacttgaatctgaaccagttctagcaaagaatccatatgtt
gttccacaagctccaaaagctccagaggttacagcaattaccaaagactctatggttgtt
gtttgggaaagaccagcatttgatggtggaagtgaaattgttggatatgttgttgaaaaa
cgagataaagaaggtatacgttgggtgaggtgcaataagagacttgtcagtgaattgcgc
tttagagtaactggtttggctgaatcacatctttatgaatttagagtttctgctgaaaat
gctgctggtctcagtgagccaagtcaaccttcaatttactacaaggcttttgatccaatt
tataaacctgggcctccaaacaaccccaaaacagtggatgttacaagatcatctgttttc
ctttcatggggcaagccaatatatgatggtggatgtgaaatccaaggctacattgtggaa
aaatttgatataagcactgatgaatggtctatgtgcactcctgcaacgggcattaaggag
acacgtcttgaagttgacagacttttggcaaaacatgaatataagttccgtatatgtgca
gtaaataaggctggtgtcggagaacatgctgatgttcctgcctcagttattgttgaagag
aaattagagatcccagaccttgatctagatctagaactcagaaaggttgtcaacgtcaga
gcaggtggttcactaagactatttattcctatcagaggtcgtccaactccagaggttaag
tgggccaaagttgatggagaaatcagagaaacagcccagattgatgttaccagcagtttc
accacacttgtccttgataatgttaacaggtatgattctggaaagtataccttaacacta
gagaacagcagtggcaccaaatctgccttcatcagtgtcagagttttggacacgccaagt
gccccagtgaatcttaagataaaggatatcaccaaggaatctgtatcactcacatgggaa
ccaccagctctggatggtggtgctaagataaagaattacataattgaaaaacgagaaacg
acaagaaaagcatatgctgctgttgctacaaactgccacaagacatcatggaaaatagat
caacttcaagaaggttgcagctattacttcagagtaacagctgagaatgaatatggaatt
ggtgttccggcagaaactcccgagcctgtgaaggtttcagaagttccacagcctccagga
aaaattactgtgattgatgtgaccaggaacagtgtgtcactgtcatgggaaaaacctgaa
catgatggtggaagtaaaatcattcagtacattgtagaaatgcaagctaaaggaagcgag
aaatggtcagactgtgctcgtgtcaagacacttgaggcagtgataacaaacttaacgcaa
ggaggtgaatacctatttagagttgttgcagtgaatgagaaaggaaagagtgacccaaga
tctcttgcagttccagtggttgccaaagacctggtgatagagccagatgtaagaccagca
tttagtaattacagtgttcaagtaggacaagacttgaaaattgaagtgcctgttgctgga
agacctaaaccaacaattgcttggacaaaagatggtcaggctctcaaacagacaaccaga
gttaatgttactgatacagcaaacatgactgtattgaatattaaggaaacaagcaaagat
gatgctggcatgtatgcaattacagtatccaatgttgttggacagaaagtagcatccatc
gaacttataacactggacaagcctgatccaccaagtggtccagtgaaatttgatgaagtg
actgctggtagtgttactttatcatggaatcctccagggtacactggtggatgccaaatc
acaaattacattgttgaaaagagagatacaactactacagtttgggagactgtttccgcc
acaattgctagaacaacacttaaggtatcaaagcttaaaactggcacagaataccagttc
aagatctttgctgaaaaccgctatggaagaagctttggactggaatctgaagctgttgta
gctcaatatccatacaaggagcctggacctccaggtacaccctcagctgcagcaataaca
aaagacagcatagttgtacaatggcatgagcctattaatgatggtggaagcagagtaatt
ggctaccatctggagcgtaaggagaggaacagtattatgtggacaaaggtgaataaaacc
attatctctgacacatacttcaagaccagcaatcttgatgaaggcattgagtatgaattc
agggtatatgctgaaaatattgttggcattggaaaatcaagcaaagtttcagagtgctac
tgtgcccgagatccatgtgatccaccaggttgcccagaggccataattgtaacaagaaat
gcaatcacattaagctggaagaaaccagagtatgatggtggtagtatgataacaggctac
attgttgaaaagcgtgatcttcctgaaggacgctggatgaaagctagctttaccaatgtt
attgaaacacagtttacagtaactgggcttacagaagatgagagatatgactttagagtc
atagcaagaaatgctgctggatcatttagcaagccttctgacagcacaggacccataact
gccaaggatgaagtagaacctccaagaatttcaatggatccaaaatacaaagacacaatt
gtcgtaaatgctggtgacacatttaaactggatgctgatgtccatggtaaacctattcca
acaattcagtggttcaaaggagaaaaagaagttgaagattcagcaaggtgtgaagttaag
aacactgacttcaaagcccttattgttgtgaaagatgctattcgagtggatggtggacaa
tacattttacaagcatcaaatgttgcaggaactaagtcagttcctattcaagtgaaagta
ttggatcgtcctggaccaccagaagggccagttcatgttactggcgttacagttgacaaa
tgctctctggcatgggctcctcctcaacatgatggtggtagtgatatttcccactatgtc
attgaaaaacgggaaacaagccgccttgcttggactgttgttgcatctgaggtagtaaca
acatctcttaaagtaacaaaactcttggaaggcaatgaatacatcttccgtatcatggct
ataaataaatatggtgttggcgagcctctagagactgcaccagttttaatgaagaatcca
tttgtgcttcctggttcacccaagtcgcttgaagtaaccaatattgtaaaggactctatg
accgtttgttggagccgaccagataatgatggtggcagtgaaatcataggctacattgta
gaaaaacgtgacagagcaggcattaggtggactaagtgcaacaaacgtaggattactgac
ctgagattgagagtcacaggactaacagaagatcatgaatatgagttcagagtatctgct
gaaaatgctgctggagttggtgagccaagccagctcacagcttactttaaagcatgtgac
cctatattcaagcctggaccaccttcaaatccacatgtagtagatacatctaagaattct
atttctgtggtttggggtaaacctatctatgatggtggaagtgaaatccaaggctatatt
ttggaaatatgcaaaggagatgaagaggagtggtcaatggtcaccccacaaacaggttta
caggttactaaatatgagattgcaaagcttattgaacatcagcaataccagattcgcatt
tgtgctataaataaggctggtgtaggtgaggctgcatcagtaccaggaactgtaaaacca
gaagacaagcttgaagctcctgaaatagaccttgattctgaacttaggaagggaatactg
gtaagagctggtggaaatgttagaattcaaattccatttagtggaagacctgttccagaa
ataagctggtcaaaagaagatggtgaactaagtgagaaggcacagattgaaagaggtttc
aactatactcagttctcaattgacaattgtgataggaatgatgccggaaaatatattcta
aaactggagaacagcagtggctccaaatctgcttttgtgacagttaaggtacttgataca
ccgggagcaccaataaacctgcttgtgaaagacataaagaaagattcagtcatacttaca
tgggagcctccactcattgatggtggtgctaaaataaagaactatgttattgacaagcga
gaatcaaccaggaaagcctttgcaaatgttacagcgaaatgcaataagacaacatacaaa
gttgaaaatcttacagaaggagctgtttattactttagagttatggctgaaaatgaatat
ggcattggcctacctgttgaaacagttgatgcagtaaaggcctctgaagcacctttgcca
cctggaaaaattacccttactgatgtaacccaaagaagtgtgtcacttatctgggagaag
ccagagcatgatggtggaagcagaattataggatatctagtggaatctcagccaaagggg
gtagagaaatggagcattgcagctgaaacaaagacatgtagtgcagttgtttctggatta
agtccaggtcaagaatattctttcagagttcttgcttacaacgaaaaaggaaagagtgat
ccaagagttcttggccttccagtaatagctaaagacttaaccattgaaccaagctttaaa
ttaatgttcaattcctataatgtacaagctggagaagatctaaagattgacatcccaata
ataggtagacctagacccactattacttgggctaaagacggtcaaacaatgaaacaaaca
acaagagttaatgttgaggacactgcagtatcaacagttttgcacatcaaagaaagcaac
aaagatgacttcggcaaatatacagtgacagcaacaaatagtgccggtacagcaactgaa
aatataagcattattgttcttgacaaaccaggcccacccaaaggacctgttagatttgat
gagatcagctctaactatgtggtattttcatgggatgctccagaatatactggtggctgt
cagataaacaactacattgtagaaaaacgtgatacaaccactaccacatggcaaacagta
tcagctacagtcgcaagaacaactattaaggtgacaaaactcacaactggttctgagtat
caatttaggatctatgctgaaaataggtatggaaagagttcacctctagactctacagca
gttgttgtacaatatccttacaaagaaccaggaccaccaggaactccatttgttacatca
gcttctaaggatcatatggttgtgcaatggaatgaacctgtaaatgatggaggaagcaaa
gttcttggataccatgtggagcgcaaggagaaaaatagcatcctctgggccaaattgaat
aagaccctccttcaagatacaaaattgaaaacaaatgggcttgaagaaggcctggagtat
gaatttagggtatttgctgagaatattgttggcattggcaaacctagcaaggtgtctgag
tgttatgttgctcgtgatccatgtgatccaccaggccgcccagaagctattgagattaca
agaaattacgtcacacttcactggagaaagccagaatatgatggtggcagtaaaataaca
ggttacatagtagaaaagaaagaattacccgatgggcgctggatgaaagctagcttcaca
aatgtgctggaaacagagttcactgctactggacttacagaagatgataggtatgaattt
agagttatagcaagaaatgctgctggtaactttagtgagccatcagaaagcactgggcct
atcactgccagagatgaaatagatgcaccaagagcatctcttgatccaaaatacaaggat
gtgattgttgttaacgctggagacacattcatccttgaagccgatattcatggcaaacct
attccagatgtcacctggtccaaagatggaaaagagattgaaacaacaactgcacgttca
gaaataaaatccacacttcaaagaacaacactaactgttaaagattgtgtccgtgtggac
ggtggtcaatatgtcctcaacctcagtaatgtaggtggaacaaagcctattcctattaca
gttaaagttcttgatcgtcctggtcctccagaaggtccactaaaggttacaggtgtaaca
tccgaaaaatgttatttggcatggggcccaccttcacaagacggtggtgcaaacatttca
cattacaacattgaaaagagagagacaagtagactttcttggacccaagttgcttcagaa
gtccaggctttgagccacaaagttacaaaacttctagcaggcaatgaatatatcttccgt
gttgtcgcagtaaacaaatatggaattggagagcccctcgaatctgaaccagttctggct
cgtaatccatttaagcctccaagtgcacctacaacaccagaagtttctgcaatcactaaa
gattctatggtagtaacatggggtcgtccacaagacaatggtggtgcagagatagatggc
tatattcttgaaaagcgtgacaaagatggtgttagatggacaaagtgcaacaaaaaacga
ttgactgatttaagacttagagcaacaggcttaacagatggacatttctatgaatttaga
gtctcagctgaaaatgcagctggtgttggagaaccaagtgaaccatctattttctatcgt
gcatgtgatgccatatatcctcccggtcctccaggaaaccccaaagtaactgatacatct
agatcatctgtatctcttgcttggagcaagcctgtttatgatggtggtgctccagtttca
ggttatattgtggaattcaaagaagcagcagctgatgaatggactactgccactcctcca
actgggttacaaggcaaacagtttacagtaacaaaactaaaggaaaatgcagaatattcc
ttccgtgtctgtgcaatcaactcagaaggagtgggagaacctgctactcttccaggaaca
gttattgctgctgacaagttagagccacctgaaattgaacttgatgcagatctgagaaag
actgttactgtacgggctggtggaagcctaagattatttgttacaatcaaaggaagacct
gaacctgaagtaaaatgggaaaaggcagaggacaaacttacagaaagagcacaaatcgaa
gttaccagctcatacacaatgttggttattgacaatgtcaacagatttgatagtggaaga
tacaacttaacactagaaaataacagtggctcaaaatctgcatttgttaatgtcagagta
cttgactcaccaagtgcccctgtaaatctgactgtcaaagaaattaaaaaggattcagtg
actttgtcttgggaaccaccgcttattgatggaggttctaagatcacaaactacattgtt
gataaacgtgaagctaccagaaaagcatatgcaacagtaacgaataactgcaccaaaaat
acatttaagattgaccagctccaggaaggaggtgtatactatttccgtgttttggctgcc
aatgagcatggcattggcctgccttcaagtacaacagacccaattaaagtatccgaagct
ccacttccccctggcagagtaactcttgtagatgtaactcgtaacagtgcaactctttca
tgggagaaaccagagagtgatggaggtagcaaaattactggctatgttgtagaaatgcag
accaaaggaagtgaaaaatggagcacttgcactcaagtaaagacgctagaggcaactatt
acaggcttgtcaagtggtgaggagtatacattcagagtgattgctgtaaatgagaaagga
aggagcgatccaagacaactgggtgtacctgtgatagccaaagatattgaaatccaacca
acaattgagttgctatttaatacttttagcgtgaaagctgggggtgatcttaagattgag
gtaccagtccgaggaagaccaattccggatataacatggaagaaagatggacaggcttta
aaacaaacaactagggtaaatgtgcagattacaaagacctctacactcctctcaatcaaa
gaaggaactaaagatgatgttggacaatatgaattaactgcttcaaacagtgcaggctct
gtaacagcttcactaggtgtgattgtgcttgataaaccaggatcaccaggacccataaag
attgacgatgtcagcgcagacaacatctcattttcctggagtgctcctgaatatgatggt
ggctgtcatataaataactacattgttgagaagagagacacaacaactacagtatgggaa
ctggtatcagcaacagtggcaagaacatccattaaagttggacgtttgacaactggttca
gaataccaattccgtgtttgcgcggaaaacagatatggaaagagccattatactgacagt
ccgtcagttgttgctcaatatccattcaaaccaccaggacctccaggaacacctcgtgtt
gctcattcaacaaaggctttcatgatagtttcttggcaaccccctgtaaacgatggtggt
agtcaagtgactgggtatcatctggagaagaaagaaagaagcagcattctctgggctaag
gttaataagagtcttatatctgacacacaactaaaagtaacaggtcttgaagaaggcctg
atgtatgaatatcgtgtctatgctgaaaacattgctggaattggaaagtgtagcaaatca
tgcgaaccagttccagcaagagatccatgtgatcccccaggtcagccagaagttactaat
atcacaagaacatctgtttcactggcatggaagaaaccagagtatgatgggggagcaaag
attacaggatacattatagaaagaaaagaactgcctgatggacgctggctaaaatgcaac
tttacaaacgtccaagacacattctttgatgtaactgcacttacagaagaccaaagatat
gaattccgtgttattgcaaagaatgctgcagggctatttagtgaaccttctgaatcaaca
ggccctattacagttaaagatgacgtagatgccccaagaattatgatggacgttaagttc
agagatgttgttgttgtcaaggcaggggaaattcttaaaattaatgctgatattgctgga
agacctcatcctgtagtttcatggacaaaagatggcaaagaaattgaagaaaaagcaaga
atagagattacctcaacagacaatagcactgtgcttgtagttaaagattgcataagaaga
gattcaggccagtatgttttaacactacaaaatgttgcaggaacaagatccttagcagta
aattgcaaagtacttgatagaccaggtcctcctgtaggtccactacaaattgctggagta
acagctgagaagtgttcactttcctggggacctccccaagaaaatggtggagcagaaata
gactactatgttgttgaaaaacgtgagaccagtcgcatcgcctggacagtctctgaatca
gaactaagaaccacttcttgcaaggtaacaaaacttctcaagggtaatgaatatgtcttc
agagtgatgggtgtcaacaagtatggagtgggagaatccctagaaagtgaagccatcaag
gcattagatccatttactattccaagtgcaccaaagtcactggagattacaagtgtaaca
aaagaggctatgacaatttgttgggcaagacctgaaagtgatggtggtagcgaaatagca
gggtatgtaattgagagacgtgagaagaacagtctgaggtggatgcgtgtaaacaaaaaa
cctgtgtatgacctaagagtaaaatcttctggtttgcgacaaggatgcgaatatgaatat
cgtgtctatgcagaaaatgcggctggtctcagtgcgccaagtgaatgctcacctttgatt
cgtgcagaagatccaattttcttgccatcaccaccatctaagcccaaaattgtagactca
actaggtcaagtgtgacaatcagctgggtgaaaccattgtttgatggaggctccccagtt
actggatacactgttgaatacaaaaaatctgatgatactgaatggacaacatctataaca
aatgtgagaggtactgagtatgcagtagttgcgctaacctctggagcagaatactcattt
agggttagatctgtcaacaaagtaggcccaagtgaaccaagtgaaagcacagagccacag
atagtgaaagacagagaagaagaacctgcttttgacattgacacagaaatgcgtaaaaca
ttgattgtcaaagcaggtggatcattcactatgacagttccttacagaggtaaacctgtt
cccaatgttatgtggagcaaaccagattctgatctacgtacaagagctacaattgatacc
acagatacaagaacctcactttccattgaaaaggccacaaggaacgattctggcaagtac
acacttacactgcagaatgttcttaacactgcaacacttacactagttgtgaaagttctt
gattctcctggacctccttcaaatattgttgtaaaagaagtgacaaaggaatctgctgtg
ctgtcctgggatgtccctgaaaatgatggtggtgcaccagttaagaattattacattgag
aaacgtgaagcaagtaagaaggcatgggtctctgtgacaaataactgtcatcgccttaca
tacaaagtcactggtctacaagaaagtggagtctactatttcagaatctctggagaaaat
gaatttggtgttggagtacctgcagagaccaaggaaggtgtaaagataacagagagaccc
agtctgccagaaaaacttggagtaaccaatgttacaaaggacagtttgtcactggcttgg
tcgaaaccagaacatgatggaggaagcaagatcctgggctatctggttgaagctctagag
aaaggacaacaaaaatgggttaaatgtgcagtggtcaagacaactcaccttgatattcgt
ggtctcaaagaaaatgtggattacttcttcagagtttttgctgaaaatcaggctggactg
agcgatcctaaagagcttcttttacctgtaactgttaaagaaaagcttgaatcacctgaa
atagacatgagaggatatccaagtaacactgtatatgtcagagcaggctcaaatcttaaa
gttgacattccagtttctggcagacctcttcctaaggtgacactgtccaggaatggtctt
ctcgtgaaatccactttgcggttcaacactgaaaccacagctgaaagcatcattattaac
cttaaagaaagtgttgcttctgatgctggatcatatgaactaacggcttccaactccagt
ggaacaactaaggccacactcaagattgttgtactagacagacctgggccgccactaggt
cctgtggtcatcagtgatgtctctgaagacagtgtaacactgcaatgggagcctccaggc
tatgatggtggaagtcaggttaccaactacattgtcctgaagagagaaacaagcactgct
gcttggtctgaagtttcctctacagtggccagaaatgtaactaaggtcatgaaactgacc
aaaggagaagaatatcaattccgtatcaaagctgaaaatcgttttggtatcagtgaccat
atcgattctgagtgtgtaactgtcaagctgccttacaccatacctgggccaccatccact
ccatgggtcaacaacgttactcgagagagtattactgtgggttggcatgagccagtctct
aatggaggcaattcagtcattggatatcacttggaaatgaaagacaggaacagcatcttg
tggcagaaagctagtaaaacaataattcgtacaagtcacttcaaggtcaacaacataagt
gctgggcttatctatgaatttagagtatatgctgaaaatgctgctggaattggaaaagcc
agccatccttcagaacctgtacttgcaattgacgcatgtgagtctcctagaaatgtccgt
gtaactgatattacaaaagtttcagtgaacctggcatggcagaaaccagcatatgatggt
ggcagcaaaatcactgggtatatggtggaaaaacgtgatttgccaaatggccgttggacc
aaggccagcttcactaatgttattgagacacagtttaacgtatctggattgactcaaggc
aatcagtatgaattccgcgtctttgccaagaatgcagttggttccataagtaacccatca
gatgttgcaggacccatcacctgtgttgacacttatggtgcacctcaaatagacatacca
ccagagtacacagatgttgtgaaattcaaggctggagtcgctgtgaaactgaagctcggt
atttctggcaaaccatttcctgctattgaatggttcaagaatggaaaagaaatacaaacc
agtgctcaggtatctattgaaagtaccagtgagttttcatcagtcctcattaaggatgct
tctcgggtgaacactggactttatgagctaaaactgaagaatgctatgggctctgcctca
gctagtatccgagtgcaaatgcttgacaaacctggcccacctgctggacttatacagttc
aagacagtcacagctgaaaagatgaccttctcctgggagccacctgctgatgatggagga
tcgaaagtgacccattacattgtagaaaaacgtgaaacaagcagaatagtgtggtctttg
gtctcagaaaagcatgaagtatgcatgataactatcaccaaacttattaaaggaaatgaa
tacatcttccgtgttagaggtgtgaacaaatatggagttggtgatcctctggagtctgaa
cctgtaatagcaagaaatgcatttgtgacacccggtcctccaagcattccggaggctgca
acaattaccaagaattctatgactgtaacctggagcaggcctactgtggatggtggaagt
gacataagtggatattaccttgagaaacgtgataagaagagcttgagatggtttaaagta
attaaagaatccatacgtgacactagacagaaagtctcaggacttacagaagacagcgaa
tatcagtatcgtgtctgtgctatcaatgcagctggccaaggtccattctcagatgcatcc
gattactacaaagcagctgatccaattgacaaacctggacaaccaacaaaactcaagatt
gtagacagtaccaagtcatcaattactcttagctggagtaagcctgtctatgatggtggt
agtccaatcacaagctatgttgtggaagttagggaaggagagagtgaagaatggactgtc
gttagcgctaaaggagaagtcagaactactgaatatgttgtttctcttcttaaacctggt
gttgactactactttagagtatgtgctgtaaatgctgcaggcaaaggagagcctatcgag
atgactgaacatacccaggcaaaggacatacttgaggagcctgagattgatctagatgtt
gcattaaggacttccattgtggcaaagcgtggtgaagatgttcagttaatgattcccttt
aaaggaaaacctaccccaactgtgacatggagaaagggagagaagaacattggaaatgac
ccaagatacaatattcagaacacagaatcttcaacattagttgatatacctcaagtcacc
cgccatgacactgggaaatatgttctgacaatagaaaatggtgtcggacagcctaaatct
acatttgttacagtaaaggtgcttgacaccccagcagagtgtcaaaagctacaaataaaa
aatgttgcacgtggcactgttacacttgtatgggagcctccactcattaatggtggagct
gaagtcaccaactatgtaattgaaaagagagatgccactaaaagagcctgggcagctgtc
acaacaaaatgttcacatacatcattcaagataactaatttgtcagaaaaaacagcctac
ttcttcagagttcttgcagaaaatgagaatggtataggagaaccatgtgaaacaacagag
ccggtgaaagcatctgaaattccaggaccaataagagatctaacaatgaaagattccact
aaaacatctgttactcttgcttggagcaaaccagattatgatggtggcagcctagtcagt
gagtatgtagtggaaagcaaactgaaggatgacaaagaatggtcaaatgcaggaatcagc
aaagcatgtgaatttgaggtctctaaactgaaggaactttcagttatggaattccaagtt
tcagctaagaatgagaaaggtctcagtgatggtgttattcttgggcccataacagttaag
gattatgttattacacctgtagctgacatttctgaaatacttggaggacagattactgta
cgtattggacacaatgtacatattgagataccatacaaaggtaaacctaggccaactata
tcttggttgaaggacagtattcctcttaaagaaagtgaacaagtcaggtttaagaaaact
gaagccaaactaagtctcagcatcaagaatgttaagaaagaaaatggtggcaaatacact
ttaatccttgacaatggggttgcccgtaagtcatatgtaatcacagtgatagcacttggt
cctccttctaaaccaaaaggacctataagatttgatgaaataagagctgacagtgtaatt
atatcatgggatgtcccagatgatgatggaggaggagaaattacatcatacagcattgag
aagcgtgaaacttctcagaccaactggaagatggtttgctccagtgttgctaggacaact
ttcaagattccaaatcttgttaaaggaatagagtaccagtttagagtgcgtgcagaaaac
cgatatggcgtaagcctaccactaaactcctctgatgttattgccaaacatcaatttaga
cctccaggcccaccaggaaaaccagttgtctacaacgttacaagcgatggaatgtctatc
acctgggatgcaccagtctatgatggtggttctgaaattactggcttccatgttgaaaag
aaagaaaggaacagcatactgtggcaacgggttaacactacacctttatctaaccgggaa
tacaggattactggactaattgaaggcctggattaccagttccgtgtattggcagaaaat
actgctggccttagccccgtaagcgagccaagcaaattcactttggctgtatctcctgtt
gatccacctggaacacctgactatattgatgtcactagagaaacagttactctcaaatgg
gctccaccacagcgtgatggaggtagcaagattgtggcttacagtattgagaggcgtcag
ggcaatgaacgctggctcagatgcaactttactgatgtttccgaatgccagtacacagtt
actggtctaagtccaggagatcgatttgaatttagaatcatcgccagaaatgctgttgga
acagtcagtccaccgtcacagtcctctggatacatcatgaccagagatgaaagcattgct
ccaactattgagtttggtcctgagcactttgaaggacttactgttaaggctggagaaatt
attagagctaaagctttgattaaaggacgtccactgccccaggttgtttggcttaaagat
ggaaaggagattgaaaagaaacttggagttgaaatcaacactgcaattggatacagcagt
atctttgtcagagacgcaacacgtgatcaccgtggtgtgtacaccgtagaggccaagaat
tcatcaggaaccaggaaggctgacatgacaataagggtacaagacacacctggccctgta
ggtggaccgataagattcagcaacatcaatggtgaaaagttgaccttatggtgggttcca
cctgccaatgatggctgtgctgtaataactcaatatgttattgaaaaacgcgagacaagc
agattgtcctgggctcaggttactgaccagtgtgaagcctgctcatacactgtaacaaaa
ttgattaagggcaatgaatatcaattccgcatttctgcagcaaataagtttggtgttggc
aaacctctcgactcagatccagttattgcacaaatacaatacactgttcccgatgcacct
ggagtgccagatgctactcatgtcaccggtgacagcattactgtaacatgggcaagacca
aaatccgatggtggcaatgaaatcaaccattatatcttagaaagaagagagaaaaagagt
ttgcgctgggttaaagtatccagtaagaagcccatcactgagaccagatacagagtaacc
ggcctggttgaaggaaatgagtatgaattccgtgcaatagctgaaaataaggcaggagtt
agtgagccaagtgcagtctctaggctaattaaatgcaaagagcctgtgaatccacctagt
gcacccagcgttgttaaagtaagtgacaccacaaagacatcagtgagcttggaatggacc
aagcctgcatttgatggtggcatggagattattggatacattattgaaatgtgcaaagct
gatcttggtgaatggcacaaagtcaatgctgaagctatagtggccacaaaatacacagtt
gttgaccttgaggctggtgaaaattacaaatttagagtctctgctgttaatggagtaggc
aaaggagacagctgtgaagtacctgctacagtacaaactacagatagattgacatctcca
gaaattgatattgatgccaacttcaagcagactcatattgttagggctggtgcaagcatc
cgtctctttattgctttcaaaggaagaccctcaccaactgcaatttggacgaaatcagac
tctgaccttagtgtgagagctgatattcatactacagactcatttagcaccttaactgtg
gaggactgtaacagatatgatgcaggaaaatacactttcactgtagaaaataacagcgga
accaagtctattacatttactgttaaagtgctggattctcctggcccaccaggtcctatt
acatttaaagatgtcacaagaggatctattacattattgtgggatgcttcactcaatgat
ggaggtgcgcgtatacatcattatgtagtggaaagaagagaagcaagccgacgcagctgg
caagtagtcagtgagaaatgcactcgacagattattaaggtttcagatcttctagaaggt
caaccatactatttccgtgtttctgctgaaaatgaatatggtgttggtgagccttttgaa
acaccagagcctattgtagccactgaagaaccagcaccaccaaaaagattagacatagta
gataccagcaaatcttcagtaacactggcttggctaaaacctgaacatgatggtggaagt
cgtatatcttcctatctgattgaaatgaaacagaagggttctgaccactggattgaagca
gggcaaacaaaacttttaacactgattgttggtaacctcacagaaaatactgaatatgag
ttccgtattcgtgcaaagaatgatgctggttacagtgagccaagggaagccttctcatct
gttattatcaaggagcctcagattgaacctacagctgatctcagtggcatcaccagacag
ctgattacctgcaaagcaggaagcaatttcacaattgatattccaataagtggacgtcca
gtaccaaaggtgatatggaaactggaagaaatgagactcaaggaaacagacagagtaaat
atcaagacaactaaagacagaaccactttgtctgttaaggacagcatgagaggtgactct
ggaaaatactacttgacacttgaaaatacagctggcatcaaaacattcactgtcacggta
atggtgattggaagaccaggtgctgtcacaggtcctgttgaggtatcttctgtatccgct
gagtcatgtgtactaacctgggctgaacctgaagataatggtggaactgaaatcacaaac
tacattgttgaaaagcgggaatctggcacaacagcatggcaacttgttaactccagcgtg
aaacgcacacagattaaagttacccacctcacaaaatacatggaatacactttccgtgta
agtgcagaaaacagatttggtgtcagcaagccttttgaatccactccaattattgctgaa
catccttttgtaccaccaagtccaccaacaagaccagaagtattttctgtgtctgccaat
gccattggcatcaaatgggaagaaccataccatgacggtggaagcaaagttacaggatac
tggattgaaaagaaggagcgcaataccattctatgggtaaaagagaacaagatctcatgc
tttgactctaactacaaagtcacatcattggttgaaggtctggagtatcagtttagagtc
tatgccctcaatgctgcaggcatcagcaaagccagtgaagcttcaagacctgtcatggca
caaaatcctgttgatccacctggaaaactagaagtgacagatgttacaagatcctcagtt
tcactaagctggactgctccactttatgatggtggcagcaaagttgttggttatattgta
gaacgcaagccattcaatgaaactggagatggtcgctggctgaagtgcaactacaccaca
atttcagaaaatgtcttcacggtcacagctctgagtgaagaagaggtttatgaattccgt
gtacttgctaagaatgcctctggtgtaataagtgctccatcagtatctactggtgctgtg
acttgcaaagatgaatactcaccacccaaagcagaacttgatagcaaacttcaaggagat
gttgttaccgtaagagctggctctgatcttgtgcttgatgcatctattggtggcaaacct
gaaccaaaagtcttctggtcaaagggagataaggaacttgatctctgtgagaaaatcaat
cttcaatacaccagcaaacgtgctcttgcaattgttaaattctgtgacagaagtgatact
ggcaaatatactttgacagttaaaaatgcaagtggaacaaaatccatttctgttctagtc
aaagtacttgactccccaggtgaatgtgcgggaaagatcactatcagtagagtaacagac
gagaaatgcacacttgcttggaatccaccacaagaagatggaggtgctgagatcaccaac
tacattgtggaaagacgtgagactagccgcctccactgggtaattgtggaacctgaatgc
ctgacactttcatgcaatgtgacgagactaattaagaacaacgagtatatattccgtata
agggcagtaaacaaatatggaccaggtgtcccactggagtctgagcctgttattgcaagg
aactcattcactatcccatcacctcctggtgcacctgaggctattggtgtaggaaaggaa
catgtaattattcagtggcttaaaccagaatcagatggtggcagtgaaattagcacctac
attgttgataagcgagagaaaaagagtgtgagatggacaagagtcaacaaagactacact
atctatgacacacgtctgaaagttactaacttactggaaggaagtgaataccaattccgt
gtcagtgcagtaaatgctgcaggaaacagtgaacctagcgattccgctccatacgtcctg
tgcaaagatccatcatataccccagcagccccatctgttccaagagtcgtggacacaaca
aaatccagcatcagcttagcatggtctaaacccttgtatgatggaggtgctgatatttta
ggctatattcttgaggtacaagaagatggcactgagcagtggtatagaccacatacaacc
acccttcttagaaatcctgagtttacactaacaggcatgaagacaagccacaaatacaag
tttagagttgctgcttccaatgcaaatggcacaagtgacttcagtgaatcatctgctgaa
attgaaccagttgaaagaatagaatctcctgacttggaacttgctgacgaccttaagaag
attgttaccatcagggcaggtggctcattgcgtctcatggtatctgtctctggaaggcca
tctccagtgatcacatggagaaaagaaggcgttgaccttgcaagccgagccatgattgat
attacagacagctatactctacttgtggttgaaaaagtaaacaggcacgatgctggaaaa
tatgtcattgaggcagtcaaccagtctggaaagaaatctgcaacagttgttgtcaaagtt
tatgattcaccaggaccttgtggtgctgtgaaagtcaaagaggtttcgaaagattctgtc
acaattacttgggatgtgcctgtcctggatggaggagccccagtaaataactatataatt
gaaagacgtgaagctgctatgagagccttcaagactgttaccacaaaatgtaataagacc
atttaccgaatcactggacttcaagaaggtctgatgtactatttcagagttttgccagaa
aacatttatggaattggcgaaccatgtgaaacatctgatgcaattttagtctccgaagtt
ccaatgataccacagaaacttgaagtagttgacattactaaatctacagtggctcttaaa
tgggagaagcctcttcatgatggtggtagcagactaacaggttatgtaattgaagcttgc
agagctggcacagagaaatggatgaaagtggcaacattgaaaccaacagttctcgatttt
actatcacatcacttaatgatggtgaagaatatttgttcagagtgagagcacaaaaccag
aaaggcgtatctgaaccacgggagatagtaactggagtgactgtacaagaccagaaagtg
ctgccatccattgatcttactggcataactcagaagactgtacatataccatctggcaga
ccaattgagcttgccttacccatacatggacgtccacctccagcagttgcatggttctat
gctggttccaggataaaagaggttgaccgtgttaagattgaaactgtaaataaagtagct
aaattaacaattagagagaccacaatcaatgacacaggagattacacacttgaaattaag
aacacatctggcacagttactgaaacaattaaagttattattcttgacaaacctggacct
ccagttggaccaatagtcattgatgatattgatgccacttctgtttctatctcttgggaa
tcaccactgatggatggtggagctacaatcagtggctatgttgtggaacaacgtgatgct
caccgtccaggatggttacctgtttctgagtcagttacaagaacaatgttcaaatttact
agactcactgaaggcacagaatatgttttcagagtggcagctacaaaccgctttggcatt
ggttccttcttgcagtcagaagtagtggagtgcaagagcagaataagtattcctggacca
cctgagactccacaagtgtttgatgtgtctcgggatggtatgactattacctggaatcca
ccagatgaagatggaggatcccagattgttggttatattgtggaacgtaaggaggtcaga
gctgatcgttgggtgcgtgcaaataaagtaccagtgacaatgacacgctacagatctact
ggacttattgaaggcttggaatacgaacaccgtgttacagctattaatgcaagaggagtt
ggaaagccaagtcgttcttctaaatctgcagttgcaatggatccaatagatcctccagcc
aagcctcagaatccaagagttactgacactacaagaacatctgtttctctggcatggagt
ccaccagaagaggaaggaggatctaaggtcactggttacttgattgaaatgcaaaaggtt
gaccaatatgaatggaccaaatgtaatactactccaaccaagatatgtgaatacacactt
acgcatcttccacaaggagcagaatacaggttccgtgtacttgcatgcaatgctggagga
cctggggaacctgctgatgttccgggaactgtcaaaatcactgaaatgctagaatatcct
gactatgagctggatcagaagtaccaggaaggtcttgttgtaagacaaggcagcgcaatt
aggatcaccataccaataaaaggaaaacctatcccagtatgcagatggaccaaggagggt
cgggatgtaagcaagagagctatgattgctacctctgacacacatactgaactcgtcatc
aaggacgctgtcagagaggactctggaacttatgacctattgcttgaaaacaaatgcggc
aaaaaagcagtttatattaaagttaaagttattggaagcccagatacaccagtaggtcct
ctggaatacgatgacattcaggcacgctccgtaagagtaagctggagagctcctgctgat
gatggtggctctgatatccttgggtacattgttgaaaggcgagaagtgccaaaagcagcc
tggtatacagttgattcacgagtaaagggaacatcattggtggtcaaggggcttaaagaa
aatgttgaatatcatttccgagtttcaagtgaaaaccagtttggtattagtcgtccactg
aaatcagaagaacctgctgtaccaaagacacctttgaatgtaccagagcctccaagcaat
gcaccagaaattgttgatgtcacaaagagctcagtcagcttgtcttggtctcgtcccaga
gatgatggtggttctcgtgtcacaggttactatattgaccgtaaagagacaactacagat
aaatgggttagacataataagacccatattactacaactatgtacaccatcactggactt
gtacctgatgctgactaccagttccgtattattgcacaaaatgatatcgggttgagtgag
ccaagtccagcttctgactcagtggtttgcaaagatccatttgataaaccaagccaacca
ggtgaaattgaagtaacatctgtatccaaggacagtataacaatacagtgggaaaaacca
gagtgtgatggtggaaaagaaatatttggatattgggttgaataccgccagtctggagac
agtgcttggaagaagtgtaataaggaacgtatcaaagacaggcagtttactatgggtggt
ttattggaagctactgaatacgaattcagagtttttgcagaaaatgaaacgggtatcagc
agacctcgcagaacagcaatgactgtgaagactaaacttacctctggtgaagctccgggt
ctaagacaagaaataaaggaggtcactactaaacttggtgaaagtgccaaactgtcttgc
cagattgttggaagaccactacctgacatcaaatggttccgctttggcaaagagctggtg
caaagccgcaaatataaaatgtcttcagatggacgtaaccacacacttacagtgttaaca
gaagaacaggaagatgaaggcttgtacacatgtgtggcagtcaatgatgctggagaaatt
gaaaccagtggtaaactgcttttggaagctgttcctcagttccatcctggattccctctg
aaagagaagtactattcgggtgtaggtacaacccttcgcctccatgtagcatacattgga
cgtccagtacctgctattacatggttctatggcaagaagcctttgaaatcttctgaaaat
atcaccatcgagaatacagaacactatacacaccttgccattaagaatgtgcaacacaag
acccatgctggaaaatacaaggtgcagctaagcaacacatttggaactgttgataccgta
cttaatgtagaaatacaagataaaccagacaagcccacaggcccaattgttgtggatgct
ttgctgaagaattctgttgtgatcagctggaaaccaccagtagatgatggtggatcaatg
gtgactaactatgttgttgaacgcagggaagctaaagaaggagaagagtggcacctagtg
tcttcttctatttctggaaccacctgcagaattgttaaccttaatgaaaatgctggctat
tacttccgtgtatcagctcagaacttgtatggtatcagtgactcattggagattccatct
attgttctaatcaagagtccatttgaaaaaccaggacaaccagcaaaaccagtgagtaca
gctgtcacaaaagattcttgtgtggtttcatggaagccaccagccagcgatggtggggcc
aagatcagaaattactaccttgagaaacgtgagaagaagcagaacaagtggatctcagta
acgaccgaggaaattcatgagaccgtctattctgtgaaaggtcttattgaagatcttgaa
tatgagttccgcgtcaaatgtgaaaaccttggaggagaaagtgaatggagtgagacatct
gatcctattgtacctaaatctgatgtacctgttcgtgctcctcagtttaaggaagaacta
agaaaccttaatgtgaagtacagaagcactgctacctttgtctgcaaagttgttggtcat
cccaagccagttgtgaaatggttcaagcaaggtaaagagatcctcccagatggagagaag
gttaaagtacaagaattcaaaggaggatactatcagcttgtcataacaaatgtctttgag
gatgattccacagtctaccaagtcagagccaccaaccaaggaggatctatatcttctaca
gcttccttggatgtagaagtccctgctaaaatccatctgcctaaacatctggaaggaatg
ggtgctgtacatgccctcagaggtgaagttgttagtataaaaattccattctctggtaaa
cccgaccctgtaattacatggcagaaaggacaggatcttattgacaacaatggacaatat
caagtcattgtaacacgttcgttcacttcacttgtcttctccaatggagttgacaggaaa
gatgcaggtttctatgtagtctgtgcaaagaacagatttggcattgatcaaaagacagta
gaactggatgttgcagatgtccctgatccaccaagaggtcttaaagtcagtgaagtttca
agagactctgttaacctcacttggactgctccagctactgatggaggcagtaagatcatt
aactacattattgaaaaatgtgcaacaacagcagagagatggattcgtgttggccagtct
cgtgaaaccagatacactgttgttaacttatttggaaaaacaagatatcagttcagaata
atagctgaaaataagtttggacagagtaaaccatctgaaccaacagatccagttgttaca
aaggaagataaatcaagaatgttgaattatgatgatgaagtatctgaaattgaaatctcc
aaaacaaaagcagaacattcttcaacaaaagtgcttcatgaaagattctcaatagctgaa
gagcttggacatgggcagtttggaattgttcaccgttgcattcacagtgcttccaagaaa
acgttccttgccaaatttgtaaaggttaaaggtgctgaccaggttgcagtgaagaaagaa
atttctgttctcaatgttgctagacacacaaatcttttgtacttgtatgaatcatttgag
agccttgaggaactggttatgatatttgaattcatctctggtgttgacatttttgaaaga
attggtgcagcaggcttcgacctctgcgaaagagagatcatttcttatgtacgccagata
tctgaagctcttgaattcctccattcaaaaagcattggacactttgatataagaccagaa
aacatcttatatacaacaagacgcagctcaagaatcaaaattactgagtttggccaagcc
aggcagttaatacctggagacagtttcagaattcagtttactgctcctgaatattatgca
cctgaagttcaccagcatgatttggtcagtacagcaactgacatgtggtctcttggtact
ctggtctatatacttctaagtggtcttaacccatttgcagctgaaacaaaccagctgata
attgagaacatcacccatgccgaatacaactttgaagatgaagcctttaaagatgtcagc
ttggaggctttggatttcattgacagacttctggtgaaagaaagaaagagccgtatgact
gcagcagaagcccttgagcactcctggcttaaacagaagtcagaaaagcaaagcacaaaa
gtgattaagacattaagacagagacgctactatcagagcttaattaagaaggaatggaat
tttgtagtctctgtggcccgcatctcttgcgggggtgctataagagcccagaagggtgtc
accgttgctaaagtcaaggttgcatcaattgaaatcggaccaatttctggacagataaca
catgctgttggagaagaagcaggatacgccaaattctcttgcaagattgaaaattatgat
caatctacacaagttacatggtattttggcatccgtcaattagaaaatagtgacaagtat
gaaatcacctacaatgaaggtcttgcaaccatctacatcaaagacatcagaaaatcagat
gatggcacctatagatgcaaagtagttaatgactatggtgaggacagttcttatggtgaa
ttgtttgtaataggtgtcagagagcaatccgactattacagatgcaggacagtgaagaag
gtaaaacgcagagctgataccatgagacttttggagagaccaccagagtttaccttgcct
ttgttccaccgcacagcttatattggtgaaaacatcagatttggtgtcacaatcacagtc
caccctgatccacaggtgacatggctgaagtcaggtcagaaaatcaagccgggtgaagat
gaaaagaaatacacatttgaatctgacaaaggtctataccagctgatcattcacaaactg
acaacagatgatgatgcagaatatactgttgtggcaaagaacagatttggtgaagacagc
tgcaaagctaagctcacagttattcctcatccagcagcagcagacaataccttacgacca
atgtttaagcgtttgcttgcaaatgctgaatgccaggaaggtcactcagtccgctttgaa
attagagtatcaggaactccaaaaccaatactgaaatgggagaaagatggtcaggccttg
gcactaggccccaacaccgaaattattcatgaaggtcttgattattatgctctcgttatt
agagacaccttgccagaagacacaggatactacagagtcactgctaccaatagtgcagga
tcaacaagctgccaagcatacctgaaggtagagcgcatgcgatatgtcaagcatgagtac
aaatctgaagaagaacgtaaggtacatgtacagaggcagattgacaagacgctgagaatg
gctgaaatccttgctggcactgactctgtcccactaacaccagttgcgcagcaagcccta
agggaggctgctattttgtataggccagcagtgagcactaaaaccgtaaaaggagaatat
gacattcagaaagaggaaaagaagaaagaagtaaaagtaatccgtatgccatatgaaatt
ccagaaccacgtgtgcatggtgcaactgcattagaagaagatcagtctatcaagaagttt
gtaccaatgtcagaaatgaaatggtacaggagattgagagatcagtatgaaatgccagaa
cctcttgagcgcatagttcaaaaacgtccaaaacgtattcgtctctcaagatgggaacaa
ttctatgtaatgccactgccacgcatcactgatcaatacaaacctaaatggcgcatacca
aaagtatcacaggatgacctggaaacagtaagacctgctcgtcgtcgtacaccatcacca
gattatgaactttattacaggccacgtcgacgctctcttggcgatgtatctgatgatgaa
ttacttctctcagttgatgactatttggctatgaaaagagttgaagaggaaagattacga
ctagaagaagagttggtacttggcttttctgcctctcccccaagtcgtagccctccaaga
tttgagctgtcaacccttcgttatacctcaccagaagctcgtgttagtagagagaagaga
actgaggcaaaatgcaggtattccgcttaccatatcccaactaaagaagaggtcacaaca
agctatgcagatcttagagagcgttatgagagagctgtatacaagccacccaaacaaaaa
caaagaatcattgaagagagagaagaagaagaattacttcgtccatacagcacatcccag
aggctttctcagtatacaagagatcttgaatacatggagaaggaagaaaaaagcagatta
ctatcaagaagagaaagagaaataacagaaataactgatgttgaagaagcacaggaagaa
gttaccaggagagtaagcagacaaatacgtcaggcatctcctgaagtatcaagattgctt
ggaaggagaagatcactctctccaacttatattgagcttatgcgccctgtatctgaacta
ataagatctcgttctaaaccagctgagccacagagaagatctcccacacctgagagaaca
aggcctcgatctcccagccctgtttctagtgatagatcactttcacgttttgaaagaaca
gcaagatttgatattatgtcaaggtatgaatcaatgaaagctgctctcaagacacaaaag
tcttcagaaagaaagtatgaagttttaactcaacagcccttcactttggacaatgccccc
cgtattactttgagaatgcgttctcatcgtgtacctgttggccggaacacaagatttatt
ctcaatgtgcaatcaaaacctacaggcgatgttaaatggtatcataatggtgttgaaatt
caggaaagcagcaaatatcatattagtaatgtgagtggagtcttgactcttgaaatcatt
gactgctattctgaagacagtggaacataccgtgctgtgtgtacaaactacaaaggtgaa
gcttctgactatgccaccttagatgtttcaggagatgatttttccacctatacaccaaag
aggaaagatgatgcggtgcctaagtctgccttcccagagctgcttaaatcagaagattat
gcatttgcttcatttaagaaaacatctgaatttgaggcaagttcttcaagaagagaagtt
aaatcacaagtaacttcattaagagaatcttcagaatcatatgaagcttatgcatctgaa
gaaaaacgggtttctgcatctgaagcaaaagcactggaagaaagagttgtacatcggaaa
tttaagagttcagagcctgcaaaaatacttaccaaaccacagtctgtcacagtatctgaa
ggtgagagtgtcaggttttcatgtgactttgatggtgaaccaactccaacagttacatgg
cagcttgctggaaaggccattgtttcctccacacgtcaccacataacatcaacaaagtac
agctctatctttgaaatcacctctgtcaagttgtctgatgaaggcaactacacagtagtg
gtggaaaactctgaaggaaagcaagaagcacacttcacactgacaattaaaagatcaaaa
gcagttgagaaaggtgttacatcaccatctagagtaaaatctccagaaccacacaagaag
tctcatgattcaataaaatcaccaaaaagagtgaaatctccagagccaacaacaccaaaa
accaagtcaacaaccaaatcaccagcagacaaggtgcagttaccagccgtttcagctccc
aaaattgctcagaatctgaaggctgtagctagtgatgacaaagctaaactgaaatgtatg
gttgagagcaccttattcaatggaagagaagtgtcatggtataagaatggcaagaagctg
agggaagatggacatttcagcttccattactcttctgatgggaactatgaactcaccatt
cacagtatctctgaagctgaccaaggcgaatacatctgtgagataactggagaaggagga
gtctccaaaaccagcctgcagtttgttggacaaacatttaaaagtgttttctcccagatt
accactgcaagagagtccaagaaatctgtccaggtatcaaaatctgtagtacatgaggag
gttggtaagactgacttggtctctgaaggaatcaagactcttcatacagagattaaatct
tcagtaagtagtgtcagttttagtgaaggccagaaagtcactcttaaggccagtatgtcg
ggagcatctcaaataaaatgggtgctcaatggatacgaactaaaaaacactgaagactac
agatatggagtatctggcagtgatcaaactttgaccatcaaaacaatcagcaacaaagat
caggggatcctgacctgtgaaggaagaacagaccaaggaataatcaaatgccagtttgac
ttgacatcaagcaaagatgcttccaatgcaccatcatttgtctaccaaccaaagtctcaa
aatgccaatgaaggtcagaatgttgtgtttacatgtgaagtcactggcaacccatcacct
gaagttgaatggtttaaagacaatattctgatttcagtctcatctcacataagagtgtct
cgatctaagaatgtatacactctagaaattcaaaatacaacagagaaggacagtggcaaa
tacacaataaaagccaagaactaccaaggacagtgttccgccaccgcctctttaaatgtt
ttccgtcttgttgaagagccttccaaggaaattgtgctgaaaactgctggtgaagctaac
ctacttgaagccttctctctgcaatccatgcaaatgtccgcttctaagcaagaagcctcc
ttcagcagtagcagtatttcagaatccaaatttgcaagtgtgtcttcagtgaaagaagca
tcctttatggaaatgcactctagcagcatgatggaatcctccagcttaagacatttggaa
agttcctccagcagaatgttgtctgcaggattcagagggagctcacctaagattgaagct
cttccatcagatgtcagcattgatgcaggaaaggttctcactgtagcctgcgccttttct
ggagaacccaccccagacatcgcatggactcaatctgggaaatccgttcctaccgacgca
cagaaaggccgagttcacatcgaaaccactgaagacctgaccaccctaaccatcacggac
gttcaaaagagagacgggggccgttatacactgaatctgtcaaatgatttcggatcggat
tctgcgtctgtgaacattaatgttcgaacaccttaa

DBGET integrated database retrieval system