KEGG   Nanorana parkeri: 108791327Help
Entry
108791327         CDS       T04897                                 

Gene name
DCXR
Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
npr  Nanorana parkeri
Pathway
npr00040  Pentose and glucuronate interconversions
npr01100  Metabolic pathways
Module
npr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    108791327 (DCXR)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     108791327 (DCXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 ADH_zinc_N Shikimate_DH DUF1776 RmlD_sub_bind F420_oxidored THF_DHG_CYH_C 2-Hacid_dh_C NmrA
Motif
Other DBs
NCBI-GeneID: 108791327
NCBI-ProteinID: XP_018417287
Position
Unknown
AA seq 244 aa AA seqDB search
MEISFAGRRALVTGAGKGIGRATVKALRTAGAAVIAVSRSPEDLESLARECPGVETVCVD
LGDWSATEASMKSIGPVDLLVNNAGVALLQPCLDITQEAFDKSFAVNVRAPILVSKIVAR
QMVEHGVPGAIVNVSSQASQVALQDHAVYCATKGALDMLTKVMALELGPKKIRVNCVNPT
VVMTDMGRANWSDPQKAAPMLNRIPMRRFAEVEDVVNSILFLLSDKSGMTTGACLPVDGG
YLIS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggagatcagctttgccgggcgccgagctctggtcaccggggcagggaaggggatcggc
cgggccacggtgaaggcgctgcggactgccggagcagcggtgatcgctgtgagccgcagt
ccagaagacctggagagcttggcccgggagtgtcctggagtggagacggtctgtgtggat
ctgggggactggtcagcgaccgaggcttccatgaaatcaatcgggccggtggaccttctt
gtgaataacgcgggagtggctctcctgcagccgtgccttgacatcacgcaagaagcattc
gataagagctttgcagtgaacgtcagagctccaattctcgtatctaagattgtggcgcgt
cagatggttgagcatggggtacccggtgccattgtcaacgtttcaagccaggcgtctcag
gtggccttacaagatcatgcggtatactgtgcgacaaaaggagcccttgacatgctaaca
aaagtgatggcgcttgaactgggtccaaaaaagatccgtgtcaattgcgtgaaccccaca
gtggtaatgactgatatgggacgtgctaactggagtgatccccagaaggccgcgccaatg
ctaaatcggattcccatgaggcgcttcgcagaggtggaagatgtggtcaatagcatcctg
ttcctgctcagcgacaagagtgggatgaccacgggtgcgtgtctccccgtggatgggggc
tacctcatcagctga

DBGET integrated database retrieval system