KEGG   Nanorana parkeri: 108792376Help
Entry
108792376         CDS       T04897                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
npr  Nanorana parkeri
Pathway
npr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108792376
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:npr04030]
    108792376
G protein-coupled receptors [BR:npr04030]
 Rhodopsin family
  Lipid
   Leukotriene
    108792376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4 Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 108792376
NCBI-ProteinID: XP_018418647
Position
Unknown
AA seq 345 aa AA seqDB search
MASVNSSFTPSNISSSTSGTSASLGIAILSVALIIGFPGNAFVIWTVLTQVKKRTVTCII
ILHLAIADMVLILTAPIFIHFLSTGNWVFGNVICKMCHYIGNLSMYTSIFLITFMSVDRF
FAVAKPFTSQQVRTKPVVRSIMFGIWILAMLFAIPMPINRSVETKNNRQQCVTVQGEEDG
VKHHLVFQYLFETLMGFFIPFTIILSSYIYIGIRLLRAKFQSKQRTSRLVIIIILTFALF
WLPYHVVNMLQVSGELSLSKSLREASKFARPNATALAFFSSSINPILYVFAGGNFIRTAG
VGFMAKLFEASGSEAGSIRKVSQVFQQRSRKQSTEQGKLKENVEE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgtgaattcttcctttacaccttcgaatataagttcatcgacttctggaacc
tcggccagccttggtattgccattctttcagtggctttgatcatcggattccctggcaat
gcatttgttatctggacagtattgactcaagtgaagaaacgcactgtaacctgcatcatc
atattacatttggctattgcggacatggtattgatccttacagcacctatattcatccat
tttctgtccacgggcaactgggtatttgggaatgtcatttgtaagatgtgccattacatc
ggcaatttgagcatgtacaccagcatctttttaatcactttcatgagtgtggatcgtttc
tttgctgtggccaaaccgttcacttctcaacaggtcagaacgaagccggttgttcggagc
ataatgtttggtatatggatattagcaatgctgtttgccattccaatgccaataaatcga
tcagtagagaccaaaaacaaccgtcaacagtgtgttactgtccaaggtgaggaagatggg
gttaagcaccatctagtctttcagtatttgtttgagactctgatggggttttttatccct
tttacaatcatcctttccagctacatctacattggaataaggttacttcgagctaaattt
caatcgaagcaaaggacaagccggctggttataataatcatattaacatttgccctcttt
tggcttccataccatgtggtgaatatgctgcaggtgtctggagaattgtctttatcaaaa
agcctaagggaagcatctaaatttgctcgaccaaatgccacagcccttgcgtttttcagt
agcagcattaaccccattttgtatgtatttgctggtggcaacttcataaggacagctgga
gttggattcatggccaagctctttgaagcatctggctcagaggcgggcagtattcggaaa
gtctcccaagtcttccaacaaagaagtagaaagcaatctacagaacaagggaaactaaag
gaaaatgtagaggaataa

DBGET integrated database retrieval system