KEGG   Nanorana parkeri: 108792391
Entry
108792391         CDS       T04897                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108792391 (ANKRD53)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    108792391 (ANKRD53)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 108792391
NCBI-ProteinID: XP_018418660
Position
Unknown
AA seq 449 aa
MAPQPLGPQKGTLDKADVTSDQLTAASVGNVDWLRLCMQAAGSHIEQDGNGFTALHMAAL
HGRLRCLKVLIEDYKMDVNLPSRCGWRALHLVLSQKNRKKAKECLQLLLRCGADVNVESE
SMVTPLHQAAREGLEDCLAILVENGADVHAKDLQGNRPIDLCKIWCHRNCARYLHNATWK
KDKEEFARELKKMETLKRNILEMDREALLKMMKTHETCFCVGTETKKPPEKARGTSIKTK
VSSDSKVSQMSSKLLPGKEQHKKKLSASEGLDKDTYKKRTNTMSSYREEGGTKRLEDDGE
HSRVQSMCQCCEWNPSSNPTMPPVTDIYRPPTLRLGIDPEDVTKPDFSDIVTLDKDEHGQ
PQIKTIQGQIFPSQPNLPYETIQRCLFPKTGPKERICMPYEFKTIHVFDVPKKQQPLEGR
KPVSEISFHLRQNLDSRLRTANKSTKRRP
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggccccccaacccctcggcccccagaagggcactctggacaaggcagatgttaccagt
gaccagctcacagcggcctccgttggaaacgtggactggctgcggctgtgtatgcaagca
gcgggctcgcacatcgagcaggatgggaatggattcacagctttacacatggccgctctg
cacggtcggctccggtgtctgaaggttctgattgaggattacaagatggacgtcaaccta
cccagtcgatgtggatggagagctctgcacctggtcttaagtcagaagaacaggaaaaag
gcaaaagaatgtttacagttgttgttgaggtgcggcgctgacgtaaacgtagagagcgag
agcatggtgacaccattgcaccaggcagccagagaaggcctggaggactgtttggccata
ttggttgaaaatggagcagatgtacatgcgaaagacctacagggcaaccgtcccatcgat
ttatgtaagatttggtgccaccgtaattgtgccaggtacctccacaatgccacgtggaaa
aaagacaaggaggaatttgcacgtgagctgaaaaagatggaaacattgaaaagaaacatc
ctggaaatggaccgagaggctctgctaaagatgatgaaaacccacgagacctgtttttgt
gtcggcacagagaccaagaaaccaccagaaaaagcaaggggtacctccataaaaactaaa
gtctcatcagattctaaagtaagccagatgtccagtaaattgttacctggtaaggagcag
cataagaaaaagctttcagcctctgagggtttagacaaggacacatataagaaaaggaca
aataccatgtctagctatagggaagaaggaggaaccaagagacttgaagatgatggagag
cattctagggtacagtcaatgtgccaatgttgtgaatggaatccaagttctaatccgaca
atgcctccagtcacagatatttacagacctcccacattgcgtctgggcattgacccagaa
gatgtcaccaaaccagacttcagtgacatagtcacacttgacaaagatgagcatggtcag
ccacaaatcaagaccattcaaggacaaatcttcccctcccagcctaatttgccatacgag
accattcaaaggtgcttgtttcccaagaccggtcctaaggaaaggatctgcatgccatat
gagtttaagaccatccatgtttttgatgtgcccaaaaagcaacagcctttggaggggaga
aaaccagtttcagaaatctcattccacttgaggcaaaaccttgattctaggctcaggaca
gccaacaagtctactaaacgccgaccatga

DBGET integrated database retrieval system