KEGG   Nanorana parkeri: 108792408Help
Entry
108792408         CDS       T04897                                 

Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2-like
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
npr  Nanorana parkeri
Pathway
npr00230  Purine metabolism
npr01100  Metabolic pathways
npr04270  Vascular smooth muscle contraction
npr04540  Gap junction
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108792408
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108792408
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108792408
Enzymes [BR:npr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108792408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF4761
Motif
Other DBs
NCBI-GeneID: 108792408
NCBI-ProteinID: XP_018418683
Position
Unknown
AA seq 168 aa AA seqDB search
VETIGDAYCVAAGLHRKNKSHAKPIALMALKMMELSEEVLTPDGRSIKMRIGIHSGSVFA
GVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKEEESFHFVSRSREELPD
NFPKEIPGICYFLELNNGQKQPKQPLTTVRMRKVSYNIGTMYLRETSV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtagaaactattggtgatgcgtactgtgtggcagctgggcttcaccggaagaacaaaagc
catgccaagcctattgcattaatggctttaaagatgatggaactctcagaagaagttctc
actcctgatggaagatccattaagatgagaataggaattcattctggctcagtcttcgct
ggtgttgtcggagtaagaatgccacgctattgtctttttggaaacaacgtcacattggcc
agcaagtttgaatcagggagtcatcctcgacgtattaatgtcagtccaacaacataccag
cttttaaaagaggaggaatcttttcactttgtttcccgatcacgtgaggagcttccagac
aactttccaaaggaaatcccaggcatctgctacttcttggagttgaacaatggccagaaa
cagccaaaacagcccttgacaactgtcagaatgaggaaggtttcctacaacattggcact
atgtatcttagggagacgagtgtatga

DBGET integrated database retrieval system