KEGG   Nanorana parkeri: 108792836
Entry
108792836         CDS       T04897                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:npr01002]
    108792836 (ADAMTS13)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     108792836 (ADAMTS13)
Peptidases and inhibitors [BR:npr01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   108792836 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS Reprolysin TSP_1 ADAM_CR_2 Reprolysin_4 Reprolysin_3 ADAM_spacer1 Reprolysin_5 TSP1_spondin CUB Reprolysin_2 TSP1_CCN Pep_M12B_propep Peptidase_M10
Other DBs
NCBI-GeneID: 108792836
NCBI-ProteinID: XP_018419210
Position
Unknown
AA seq 1584 aa
MTRFVLVLLALAVLSPGACALWDTTEMFLKTLDSEGFLSYFGTENISASDIALTNLTCTC
EDTSWTPLCSATLCTLHSHLGKYSFTFQEKYRPVTAQRVLNASMHHLMQFPKSCGSIGTA
LYPHGARSLVTFCDGQLRGFITTDFYHFFIQPLKKRHSMQRQGLSDLHIMSRAEIAHTDS
PKHHEAHHLSKRAAVGVKHLELLVVAGYDVYQFHQEDTERYILTNLNIGAELLRDVSLGA
SIRVHLVKMIILTEPEASIQISPNLTSSLMSMCEWSRKINPQSDFDPQHADLVLYVTRFD
LELPDGNNQVRGVTQLGGACSYSWSCVITEDTGFDLGITMAHEIGHSFGINHDGTENSCR
GSGNVMAAEGNHNSVHLTWSECSREQLLYFLSSSAASCINDLPALEDNIPSLKPGLYYGA
NEQCQIAFGSSALACTFSRNDLDMCSVLSCHVSHEDLTSCSRLFIPLLDGTECGQNKWCH
KGRCRSLEELNPVAAVHGVWSSWSSFSPCSRSCGGGVIVRKRQCNNPRPAFGGRDCRGAN
LQAKMCKMQDCRNTQLDFMTEQCAATDNKPLTLSPGVVSHYRWTSAAAFAHGDELCQYLC
QAQGNNFMVRRGDSFADGTRCEQSAEANGMFNICVAGRCKVFGCDGVMDSVMAADHCGVC
GGDNSTCSKVSGSFTEGKAGEYFTFLTVPVGAMTLRVTNQKPLFTHLAIKENSGYIVAGK
RSISLNITYPSVIEDKQLEYRLILTANKLPGLEEVLIGGPTSSDIEIQVYRKYGPEYGEV
TNPDITYSYYIAKKDHSYAWLPVPAPCSASCGGGFRNVVYECFDHILQMAAQSKFCNSSE
VFGPTQEPCGDDPCPPRWHIKETSACTVFCGGGLMSRTVQCVQKLRDTEAVIPDWQCAHT
SRPEAFVSCNTEPCPTRWKVSETGPCLAICGSGTARRKVSCVQSQSGLEVMVDVSKCSRQ
EKPQEHLPCVVSVCPVGWESIISSVKGDLPLIDSHFWNDTQVFVWSPIQGECSVTCGTGS
LELHYICVQFYSKEEAPEKSCNHTLKPDKQQRPCRPQSCPPFWEVEELSPCPLSCGGGII
PLSVTCVRKENDILYRLPPSKCSHLPHPGFMKPCTTEPCPVRWRYKTGSCSVTCGGGILQ
RVLYCTQDSQQGSSEEKIVPDIQCQHLPHPQEQEPCNQQPCPPRWRVVESTPCSAGCGYG
ISRQKVICVQTVAGNDTEQDSGSCPSHERPLSVIPCFITQCFYTWDVRPWTQCSVTCGNG
VQQREEFCINSKTHQHVSPALCGHTPKPITLRGCSEKPCLQDTQTAQPDAAHMLMRTLQT
SVVPDQQKPHYRAIPFVSIIAPDRTGGPATVDGVCGRLFLNASAIINTSGILENDCMFSI
GRPLGEIIVIKILSSSLNCSAGELVLFYGRAMWRKACTRISAVTVVTRSNTVIVRQRQVH
PGNGIALEYSTKPATQSYHQDCDVQLFGMQGDIRNPIQSQSGSDSPACRIFIDVPPKFTI
AVHALYMDLEKGTNKTQSDYILIWDMKSMKSTAFHGNHLFYWESTGSRAEVEFNGDFSQD
RVSFRAQYWAKERGKPTQNGESVV
NT seq 4755 nt   +upstreamnt  +downstreamnt
atgacccggtttgtactggtactgcttgcacttgctgtgctctcccctggggcctgtgcg
ttgtgggacaccactgagatgttcctgaagacactggattccgaggggttcctctcatac
tttggcaccgaaaacatctcagcctctgacattgcattgacaaacctgacatgtacctgt
gaggatacatcctggacaccactgtgctctgccaccctttgcacccttcactcccacctg
ggaaaatatagctttacattccaggagaagtaccggcctgtcactgcacagcgggtttta
aatgcttctatgcaccacctcatgcaattcccaaagtcttgtgggtcaatcgggactgcg
ctgtacccccatggggcgagatctctggtaactttctgtgacggacagctgcgtgggttt
atcacgacggacttttaccatttctttatccagccgctaaagaagaggcattctatgcag
agacaaggactttcagaccttcatataatgtccagagcagaaattgcacacacagattca
ccaaaacaccacgaagcccatcacctgtcaaaaagagcggctgtcggggttaaacatctg
gaactcctggtggtcgctggttatgacgtctatcagtttcatcaggaggacacggaaaga
tatatccttaccaacctaaacattggggcagagctgctgagagatgtctccctcggagcc
tcaatccgcgtccatttggtcaagatgatcattctcactgagccagaggccagcatccag
atcagtcccaacctaacgtcatctctgatgagtatgtgtgaatggagcaggaaaatcaat
cctcagagtgactttgacccccagcacgctgatctcgtcctctacgtcaccaggtttgat
ctagagttaccggatggaaataatcaagttcgaggggtgacccaactgggtggggcatgc
tcatattcctggagctgtgtcatcaccgaagacaccggctttgacctggggatcactatg
gcccatgagattgggcacagttttggaataaatcacgatgggacggaaaacagctgcaga
ggaagtggaaacgttatggcagctgaggggaaccataacagcgtccatttgacatggtcg
gagtgcagccgtgagcagctcctttattttctcagcagtagcgcagcaagctgcatcaac
gacttaccagcactagaggacaatataccaagcctaaagcctggtctgtattatggagcc
aacgagcagtgccaaatcgcatttgggagctcagcactggcctgtaccttttccaggaat
gatctggacatgtgcagcgtcctctcctgtcacgtcagccatgaagatttgaccagctgc
agccgactcttcatcccacttctagatggcactgagtgcggccagaacaagtggtgtcac
aaaggtcgctgcagatccctggaggagctgaatccagttgcggctgtgcatggtgtctgg
tccagctggagctccttctcgccttgttcccggagctgcggtggtggagtgattgtgcgg
aaaaggcaatgtaacaatccaaggccagcttttggtggtcgggactgcagaggagccaat
ctccaggctaaaatgtgtaaaatgcaggattgcagaaacacacaactagattttatgaca
gaacaatgtgcggctacagacaacaagcccctcaccctgtcccctggggtagtttcacac
taccgctggacatcagctgctgcctttgcacatggcgatgagctttgccagtatttgtgt
caggcacaaggaaataacttcatggtgcgacgaggggacagcttcgcagacggcacccga
tgcgagcagagcgcagaggcaaatggcatgtttaacatctgtgtagccggccgatgcaag
gtctttggctgtgatggagtgatggattctgtgatggcggcggaccactgtggagtatgt
ggtggggacaacagtacgtgcagcaaagttagtggctcatttacagaaggaaaagctggg
gagtatttcacattccttactgtccctgtcggagccatgacactgcgagtgactaatcaa
aagcctctgtttactcacttagctattaaagagaactcgggctacattgtagctggaaag
cggagtatctctttaaacatcacgtacccctctgtcatagaggacaagcagctggagtac
agattgattttaactgctaacaagctacccggtctggaagaagtccttatcggtggaccc
acctcctccgacattgagatacaggtgtacagaaaatacgggccagaatatggagaggtc
accaatccggacatcacctacagctattacattgccaaaaaggatcattcatacgcttgg
cttccggtccccgcaccctgttcagccagctgtgggggaggatttcgaaatgttgtctat
gaatgctttgaccacattcttcaaatggcagcccaatccaagttctgtaattcttctgag
gtttttggtccaacacaggaaccttgtggagatgacccctgccctccgcggtggcacata
aaggagacctctgcttgtaccgtcttctgtggagggggacttatgagcaggacagtccag
tgtgttcaaaagttgcgtgacactgaggccgtcattccggactggcaatgtgcccacacc
tctaggccggaagcctttgtttcctgtaacacagagccctgcccaacgaggtggaaggta
tcagagaccggtccttgcttagcaatctgcggctcgggcacagcaaggcgtaaagtctcc
tgcgtacaatctcagtctggcttggaagtcatggtggatgtctctaaatgctcaaggcag
gagaagccacaagaacatcttccatgtgtggtcagcgtgtgccctgttggctgggagagt
atcatttcttcagtaaaaggagatttacctctcattgactcccacttttggaacgacaca
caagtctttgtgtggagcccaatacagggtgaatgttctgttacttgtggcactgggtct
ttggaactacattacatttgtgtccagttttattctaaagaagaagcacctgaaaagtcc
tgcaaccataccctgaaaccagacaagcagcagcgcccatgccgaccgcagagctgcccg
ccattctgggaggtagaggagttgtcaccgtgtccactatcttgcggaggaggaataatc
ccactttctgtgacatgtgtccgaaaagaaaatgatatcttataccgactacccccctcc
aagtgcagccacttacctcatccaggcttcatgaaaccgtgcaccaccgagccctgtcct
gtccgatggcgctacaagactggatcctgtagtgtgacctgtggagggggaattttacaa
cgtgttctctattgtactcaagacagtcagcagggcagtagtgaggaaaaaattgtacca
gatatacaatgccagcacctgcctcatcctcaagaacaggaaccttgcaaccaacagcct
tgcccaccaaggtggcgagtggtagagagcactccatgctctgctggttgtggctatggc
atatccaggcagaaggtgatatgtgtgcagacagtggctggcaacgatacggagcaagac
tctggatcttgtccatcccatgaaaggcccctgtctgtcatcccgtgctttattacccaa
tgcttctacacttgggatgtgcggccctggacacagtgttcagtcacctgtggtaatggg
gttcaacagcgggaagaattctgcatcaactcaaaaacccaccaacatgtaagccccgcg
ctctgtggacacacgccaaaacccatcacgctacgtggctgttctgaaaagccatgcctg
caggatacacagaccgcccaaccggatgcagcccatatgttaatgagaacactgcagacc
tctgttgtcccggatcagcagaaacctcattatagagctataccctttgtcagcattata
gcaccagacaggactggcgggccagccacggtggatggtgtgtgtggacggctcttcctg
aatgcttctgcaataatcaacacctccgggattctggaaaacgattgtatgttctcaata
ggacggccgctgggagagattattgtcatcaagattctgtccagctcccttaactgctca
gctggtgagctagtattgttctatggcagagctatgtggagaaaggcgtgtacccgtatc
tcagcagtcacagtggtaacgcgatcgaacacagtgatcgtgagacagcgccaagttcac
cccggtaatggaattgctctggagtattcaactaaaccggccactcaaagctatcaccaa
gactgtgatgtgcagctgttcgggatgcagggagacatacgaaatcccatacagtcacag
tccgggtcggactcccctgcttgtcgtatctttattgacgtgcctcccaagtttaccatt
gcagtccatgccttgtatatggaccttgagaaagggaccaataagacacagtcagattac
atcctgatctgggacatgaaatcaatgaagtccaccgcattccatggaaatcatttgttc
tactgggagtccacagggagccgggcagaggttgaattcaacggtgacttctcacaggac
agagtcagtttccgggcgcagtactgggcgaaggagagggggaagccaacccagaatgga
gagtctgttgtctga

DBGET integrated database retrieval system