KEGG   Nanorana parkeri: 108792991Help
Entry
108792991         CDS       T04897                                 

Gene name
CNP
Definition
(RefSeq) 2',3'-cyclic-nucleotide 3'-phosphodiesterase isoform X1
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npr04147]
    108792991 (CNP)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     108792991 (CNP)
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   108792991 (CNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase AAA_33 Zeta_toxin KTI12 ABC_tran AAA_18 AAA_16 NB-ARC AAA_14 AAA_22 AAA_30 AAA_17 AAA_5 6PF2K G-alpha AAA NACHT APS_kinase Viral_helicase1 Sigma54_activat RuvB_N CPT AAA_29 KAP_NTPase DUF4914
Motif
Other DBs
NCBI-GeneID: 108792991
NCBI-ProteinID: XP_018419392
Position
Unknown
AA seq 449 aa AA seqDB search
MCARVTSALQLSGFPHWLCNTLRGGCQVGSIFRSFKPSTEKPLNCRMSSQASKDQHEGQK
PPLLVDDHTVVTVRESKILVLLRGLPGSGKSTLAKDIEQKYKETSRLISADQYEIKPVIR
SSSGGDYTKLDDELTTCFERREANLVILDDTHHDHERLDELFDLANKYHFIVVVLEPKTP
WRLDCAQLKDRNHWKLSLEELKNLRPSLEKDLLPLYFGWFLAKRDEDSLRKTSHEFLEQL
GNLKAFKKRLQAYGYEDKHKLDLLKHFAKTPNILHCTTKFCDYGKVAGSEEYTRQEVVKK
SYSKGYTLHITALFATPRTVGARVELTEEQLLLWPLDAEREVMPKDTFPRGSRAHITLGT
AAEVQDVQTGIDLLEFMKLQQGGREGESLGELTGSVAGKVSYFENGMWLVNLSRKIEVKS
IFSGYYGKPGVNVPLRGSKKGLLQQCHIM
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctcgggtcaccagtgctctgcagctttctgggtttccacattggttgtgcaac
acgctgagaggcggctgtcaggttgggtcgatttttaggagtttcaagccaagtaccgag
aagcctctaaactgcaggatgtcttcgcaagcctcaaaggatcagcatgaaggccagaaa
cccccactattagttgatgaccacactgtagttactgtcagagaatcaaaaattttagtt
cttctaaggggccttcctggaagtggaaagtcaacattggctaaagatatcgaacaaaaa
tataaagaaacatcacgtctcatctctgctgaccaatatgaaatcaaaccagtaattagg
agttctagtggaggagattacactaaattggatgacgaattaacaacttgctttgaaagg
cgtgaagctaatttggttatccttgatgacacacaccatgatcacgagcgtctggatgag
ttgtttgatttggccaacaagtaccatttcattgtagttgtcctggaacccaagacacct
tggagactggactgtgcacagttgaaagatcgaaaccactggaagttatcattagaagag
cttaagaacctgaggccctcactggagaaagatctgcttcctctgtactttggatggttc
ctagctaagcgggatgaggattctctgaggaagaccagccatgaatttctggagcagctg
ggaaatttgaaggcctttaaaaaacgtttacaagcatatggttatgaagataaacacaag
ttggatcttttgaaacattttgccaaaacccccaacatactgcactgtacaactaaattc
tgtgactatgggaaggttgcaggttcagaagaatatacacgtcaagaggtcgtgaaaaaa
agctactccaaagggtatacactgcatatcaccgctctctttgccacccccaggacagtg
ggagcacgagtcgaactcacagaagagcagctcttactttggcctctagatgccgagaga
gaagtgatgcccaaggatacctttccccgcggaagccgtgcccacatcaccctgggcacc
gcagctgaggttcaggatgttcaaactggtattgaccttctggagtttatgaagctgcag
caaggtggcagggagggtgagagtttgggtgagctgactgggtcagttgctggtaaagtc
tcctactttgaaaatggaatgtggcttgttaacctgtccagaaagattgaagtgaaatcc
atcttttctggttactatggaaaaccaggtgtcaatgtacccctgcgtggtagcaaaaag
ggtcttttacagcagtgtcacattatgtaa

DBGET integrated database retrieval system