KEGG   Nanorana parkeri: 108793498Help
Entry
108793498         CDS       T04897                                 

Gene name
PARP8
Definition
(RefSeq) poly [ADP-ribose] polymerase 8 isoform X1
  KO
K15258  poly [ADP-ribose] polymerase 6/8 [EC:2.4.2.30]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108793498 (PARP8)
Enzymes [BR:npr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108793498 (PARP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N
Motif
Other DBs
NCBI-GeneID: 108793498
NCBI-ProteinID: XP_018419956
Position
Unknown
AA seq 851 aa AA seqDB search
MGMCSRQERIQKDIDIVIQKCKAEKDCLFSDFKYSDSTFTFTFLGGTKSVAYSVHVSEDY
PDNTYVSSSENDEDVLVTTEPIPIIFHRITELRKSNDITSCLSIKSKLQKENGEESRHGS
AVEEDSEGDNDSEEFYYGGQVSYDGELHKHPQLEADLAAVREIYGPTAVSLREYGAIDDV
DIDLHIDVTFLDEEIAVAWDVIRTEPIVVRLHCSLTQYLNGPVPTVDVFQISTKEKFGLG
HQLKKIMQTFVMQQWKQSKEKLICSHKKMSEKKVKSPLHIFSTLRRSPSYPPPGCGKSKV
KLKSEQDGISKTHKLLRRTCSSTVKPEDMCNPKSHRNFGRSLSSDPRAEQPMGLKPHKLL
NRQCSTAIKQEECIPLKQHKLLTRSCSGDPRCEHNSTLKPHKLLSRSYSSNLRMEELDGL
KNHKLLSKTCSSAPKSSKMDLLKEPIAEGRRLSLTSGLIGILTPAASSQPAPTNNAKSMP
ARAHGFLVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQTLGVM
NEAADEIATGAQVVDLLVSMCRSALESPRKVVIFEPYPSVVDPNDSQALAFNPRKKNYDR
VQKALDSIASIREMTQAPYLEIKKQMDKQDPLAHPLLQWVISSNRSHIVKLPVNRQLKFM
HTPHQFLLLSSPPAKEANFRTAKKLFGSTFAFHGSHIENWHSILRNGLVVASNTKLQLHG
AMYGSGIYLSPLASISFGYSGMNKKQQKVSAKDDPPSGSKSSSATQSQKKGQQSQFLQSR
NLKCIALCEVITSQELHKHGEIWVVPTTDHVCTRFFFVYEDGQVGDTSINTQEPSSYKEI
LRVIGNQTATG
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggggatgtgttcaaggcaagagaggattcagaaggatatcgacattgtcatccaaaag
tgcaaggcggagaaggactgcctgttttcagatttcaaatactcggactccactttcacc
tttaccttcctcggtggcaccaaaagtgttgcatattcagtacatgtctctgaggattat
ccagataatacatatgtatcaagctcagaaaatgatgaagatgtgttagttacaacagaa
cccatccccatcatcttccacaggattacagagctgaggaaatccaatgacattaccagc
tgcttgtccataaaatctaaactgcagaaagaaaatggagaggagtctcgacatggcagt
gcagtggaagaggattctgaaggcgacaatgattctgaagagttttattacggaggacag
gtgagttatgatggagaactacataagcacccacagctggaagctgacctggcggcagtg
agagaaatctatgggcccaccgctgtatctctcagggaatatggagcaattgatgatgtg
gatatcgatttgcatattgatgttaccttccttgatgaagaaattgctgtagcgtgggat
gtgatccgcacagagccgattgtagttcgcctccactgttctctcacacagtatttaaat
ggcccagtgccaacagtcgacgtctttcagatatctacaaaggaaaagttcggtttggga
caccagttgaaaaagatcatgcagacgtttgtaatgcagcaatggaaacagagcaaagaa
aagttgatttgttcgcacaagaagatgtcggagaagaaggtgaagtctccactgcacatt
ttttctacactgcgcaggtcgccaagttatccccctcctggatgtggtaaaagcaaagtg
aagctgaaatctgagcaggacggtatctctaaaacccacaaactcctgagaaggacttgt
tctagcacagtgaaacctgaagacatgtgtaacccaaaatctcacaggaactttggccgg
tcgctgtccagtgaccccagggcggagcagccgatgggcttgaaaccacacaaacttttg
aaccgccagtgttctacagccattaagcaggaggaatgcatccccctgaaacaacataaa
ctcttaactcgttcttgttctggggaccccagatgtgagcacaacagcaccttgaagccg
cataaacttttaagcaggtcttattctagtaatcttcgtatggaagagttagatggactc
aagaaccacaaactactcagcaagacctgttccagtgcccctaaatcatccaaaatggac
cttttgaaagaacctatcgcagagggcaggaggctctctcttacctcagggctgattggt
atattaacgccagctgcatcatcacaacctgctcctaccaataatgcaaaaagcatgcca
gcacgagcgcatggatttctcgtccagacaatagagtttgcagagcaaagaatacctgtg
ctcaacgagtactgtgtggtttgtgatgagccccatgtttttcaaaatggaccaatgctg
aggcccacagtgtgtgaaagagagctgtgtgtattcgcttttcagacattaggtgtaatg
aatgaagccgcagatgaaatcgccacaggtgctcaggttgtagatctgctagtatcaatg
tgtcggtctgctttggaatctccaagaaaagttgttatttttgagccatatccttcggtg
gtagaccccaatgattctcaggccctggcctttaatcccagaaaaaagaattacgacaga
gttcagaaggcattagacagcatcgcttccatcagagagatgactcaagcaccttatttg
gaaatcaagaagcagatggataagcaagatcctctggcccaccctttgctgcaatgggtg
atttcaagtaatagatctcatattgtgaaattgccagttaacaggcaactgaaatttatg
cacacccctcaccagttcctacttctcagcagtccaccagccaaagaagcgaatttcaga
actgctaaaaaactcttcgggagcacatttgcatttcatggctcgcacattgaaaactgg
cactccatcctgaggaacggattagtagtagcttccaatacaaaacttcagcttcatggt
gccatgtatggaagtggaatatatctcagccctttagcaagcatttcgtttggttactca
gggatgaacaagaagcagcagaaagtatcagccaaggacgacccgccatcgggcagtaaa
agcagtagtgcaacacagtcacagaaaaaaggacaacaatcccaatttttgcaaagccgt
aacttgaaatgtatagccttatgtgaagtgattacttcacaagaattgcacaaacatggg
gagatctgggtcgttcccactaccgatcatgtctgtacacggttcttttttgtctacgaa
gatggtcaagtaggcgatacaagcatcaacacacaagaacctagtagctataaagagatt
cttcgagtcatcggtaaccaaacagctactggataa

DBGET integrated database retrieval system