KEGG   Nanorana parkeri: 108793508Help
Entry
108793508         CDS       T04897                                 

Gene name
ANXA7
Definition
(RefSeq) annexin A7 isoform X1
  KO
K17095  annexin A7/11
Organism
npr  Nanorana parkeri
Brite
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108793508 (ANXA7)
  Exosomal proteins of other body fluids (saliva and urine)
   108793508 (ANXA7)
  Exosomal proteins of colorectal cancer cells
   108793508 (ANXA7)
  Exosomal proteins of bladder cancer cells
   108793508 (ANXA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 108793508
NCBI-ProteinID: XP_018419974
Position
Unknown
AA seq 514 aa AA seqDB search
MSYPYQQQSGFPGYPGYPAGDPAYTPGGQQAYPGGQYPPAGGGAYPPAAGGGYPPPGGYP
AAGGYPGGMPSYPQGPGYGAPGQGAGYGAPGQGAGYGAPPGAPGYGAPGGAPGYGGAGFG
APSGGFGAPAGGQYGAGGYNVPPGGAPAAGGYGAPPGGAPGYGGYQQPSVQTYGGGAPGG
YPAGPAPGQQPAPFAAAMAATQGTIRPAANFDALADAEKLRKAMKGFGTDEKTIVDVVAN
RSNDQRQKIKAAFKTAYGKDLIKDLKSELSGNVEELIIALFMPPTYYDAWSLHNAMKGAG
TKEKVLIEIMCTRTNAEIRNIVQCYKSEFGRDVEKDIRSDTSGHFERLLVSMCQGNRDES
TNVNVQQAESDAQRLYQAGEGKLGTDESSFNLVLASRSFPQLKAVAEAYARISKRDLLTT
IGREFSGYIEDGLKAILQCAINRPAYFAERLYKSMKGAGTNDSTLIRVVVTRSEIDLVQI
KQAFAQTYQKSLASMIQSDTSGDYRSLLLAITGQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacccatatcagcagcaatcggggttccctggatatccaggctatccagcaggt
gatccagcatatactcctggcggccagcaagcgtaccctggtgggcaatatccacctgct
ggtggaggtgcatacccaccagcagctggaggtggatacccaccacctggaggataccct
gctgctggtggctatcctggtgggatgccttcatatcctcaaggtcctggatatggagct
ccgggtcaaggtgcaggatatggagcaccgggtcaaggtgcaggatatggcgctcctcct
ggtgccccgggttatggagcaccaggtggagctcctggctatggtggagctggttttggt
gccccatccggtggatttggagctccagcaggaggacaatatggggctggaggatacaat
gttccaccaggtggtgctcctgcagcgggtgggtatggtgcaccacctggaggggctcct
ggatatggaggataccagcagccttctgttcagacctatgggggaggagcaccaggtgga
tatccagcaggacccgcaccagggcagcagcctgcaccgtttgcagcagccatggctgcg
actcagggcaccatcaggcctgcagcaaacttcgatgcattggcagatgcggaaaagctg
aggaaagccatgaaggggtttggaactgatgaaaaaacaatagttgatgttgttgcgaat
cgctctaatgaccagagacagaaaattaaggcagcatttaaaactgcttatggcaaggat
ttgattaaagatctgaagtctgaattaagtggcaatgttgaagaactcatcatcgcgctg
tttatgcctcccacctactatgatgcttggagtttgcataatgccatgaagggtgcagga
acgaaggagaaggtgctgatcgagatcatgtgcaccaggactaatgctgaaatcaggaac
atagtgcaatgctacaagtcagaatttggacgggatgttgaaaaagatatccgatctgac
acctctggccactttgaaagactgcttgtgtctatgtgccagggtaatcgggatgaaagt
accaatgtgaatgtgcagcaagctgaatccgatgcccagcgcctctaccaggctggggaa
gggaagttgggaacagacgagtcctcctttaatctggtgctggcaagtcgaagctttcca
caattgaaagctgttgccgaggcctatgccaggatttcaaagcgggatttgcttactaca
atcggccgtgaattttctggctacatagaagatggattgaaggcaatcttgcagtgtgct
ataaaccgtccagcctactttgcggagagactttacaagtccatgaagggagctggtaca
aatgattccactctgatccgagttgttgttacccgcagcgagattgatcttgttcagatc
aaacaagcctttgcccagacgtaccaaaagagtcttgcctccatgatccagagtgataca
agtggggactacagaagtctgctgctagcaataactggccagtag

DBGET integrated database retrieval system