KEGG   Nanorana parkeri: 108794027Help
Entry
108794027         CDS       T04897                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
npr  Nanorana parkeri
Pathway
npr00010  Glycolysis / Gluconeogenesis
npr00562  Inositol phosphate metabolism
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108794027 (MINPP1)
   00562 Inositol phosphate metabolism
    108794027 (MINPP1)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108794027 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108794027 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Tubulin_3
Motif
Other DBs
NCBI-GeneID: 108794027
NCBI-ProteinID: XP_018420496
Position
Unknown
AA seq 479 aa AA seqDB search
MSLIFSECRRYVPKAAQVLLISATWFCSLHGLSTCGSPKLATYFGTKTRYEEVNPFLLVN
PLLVSRKHDLLPNMCTPLQIVSVIRHGRRYPTQKQIQKMKTIYNLIKQSESNSQLVKELQ
SWNMWYDDWMDGQLVKKGEDDMKNLAYRFASLFPSLFTAEKLQKCKMSFTTSSKHRCVDS
TKSFIKGLAHNYLQLPELPDTEQEDITCSEPMVNDTLMRFFDHCEKFVVQVEDNDTAMHE
VDRFKIGPEMQKVIHKVATLLGVPEDQLNADLIQVAFFTCSFELAINNIQNSPWCHLFDE
EDAKVLEYLNDLKQYWKRGYGFDINSRSSCNLFQHIFQHLETAVSESKRSQQISNPVVMQ
FGHAETLLPLLALMGLFKDEKPLTADSFSSQSEQKFRSGRIVPYASNLVFVLYHCDLVES
PKEEHQVQMLLNENLLPFPHSKESVCLFDDLKKEYSHLLNDCRVKEECELMKAVHEDEL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaatattctctgaatgccgaagatatgtccccaaagccgcccaggtccttcta
atctctgccacgtggttctgcagtttacatggactctccacctgcgggtctcccaaacta
gctacttattttggaaccaaaaccaggtatgaagaagtcaatccgtttctcctggtgaat
ccactactggtttctagaaagcatgatctactgcccaatatgtgtacacctcttcagata
gtgtcagtgatcagacatggtaggagatatccaactcaaaagcaaatacagaagatgaag
acaatatacaacctaattaaacagagtgagagcaattcacaactggtgaaggagctgcag
agctggaacatgtggtatgatgactggatggatggtcagctggtgaagaaaggagaggac
gacatgaagaatttggcttatagatttgcttctctcttcccatctctcttcactgcagag
aagctccagaaatgtaagatgtccttcaccaccagctctaagcatcgatgtgtagacagt
acaaaatcctttattaaaggtctagcccataactacctccaactcccagaacttccagac
actgagcaggaagatataacatgtagcgaacccatggtgaatgacacactcatgcggttt
tttgaccattgtgagaagtttgtagtccaggtggaggacaatgacacagcaatgcatgaa
gtggaccggtttaaaataggaccagaaatgcagaaagtaatacacaaagttgctactcta
ttaggtgtccctgaagatcaactaaacgcagatttaatccaagtggctttttttacctgc
tcatttgaactggccattaacaacattcagaattctccgtggtgccatttgtttgatgaa
gaagatgcaaaagtcctagaatacctgaatgacttgaaacagtactggaaacgtggctat
gggtttgatatcaacagccggtccagctgtaacctgttccaacatatcttccaacatcta
gaaactgcagtctctgaaagcaaaaggtcccagcaaatctccaatcctgtggtcatgcag
tttgggcatgcagagactctcctgccacttttggctctgatgggcctctttaaggatgag
aagcctcttactgcagacagcttttctagtcaaagtgaacagaagtttcgcagcggcaga
attgtgccttacgcttcaaacctagtgtttgttctgtatcactgcgacttggtggagagt
cctaaagaagagcatcaagtacagatgttactgaatgaaaacctccttcctttcccacac
tcaaaggagtctgtgtgtctttttgatgatctcaaaaaagagtacagtcatctgctcaat
gactgccgtgttaaggaagaatgtgaattgatgaaagctgttcatgaagatgaactataa

DBGET integrated database retrieval system