KEGG   Nanorana parkeri: 108794160Help
Entry
108794160         CDS       T04897                                 

Gene name
ARG2
Definition
(RefSeq) arginase-2, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
npr  Nanorana parkeri
Pathway
npr00220  Arginine biosynthesis
npr00330  Arginine and proline metabolism
npr01100  Metabolic pathways
npr01230  Biosynthesis of amino acids
Module
npr_M00029  Urea cycle
npr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108794160 (ARG2)
   00330 Arginine and proline metabolism
    108794160 (ARG2)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     108794160 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 108794160
NCBI-ProteinID: XP_018420655
Position
Unknown
AA seq 356 aa AA seqDB search
MPIRSCFTMLLKRSASTIFLRKKCTQSVAIIGAPFSKGQKWRGVEHGPAAIRNARLIERL
SSIGCDVYDVGDLHVAQVPNDKLYNNTVKYPRTVGLACQMLANEVRRVLEAGHTCVTLGG
DHSLALGTISGHARQCSDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPSI
PGFSWIKPCLSTADIVYIGLRDLDAAEQFILKKYNITYYSMRQIDRLGIQKVMERSFEQL
LGRKQRPIHLSFDIDAFDPSLAASTGTPVIGGLTYREGIYITEEIHNTGMLSALDLVEVN
PALGASSDEVKATTNLAVDVIASCLGQTRECTQVIIEELPTPTTEFATENEEQIRI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcctattaggtcttgctttactatgttgttaaaaaggagtgctagtacgatttttctg
cggaagaaatgcacccaatctgtggctattattggggctccattctccaagggccagaaa
tggcgaggtgtagagcatggaccagctgcaatcagaaatgccagacttattgaaaggctc
tccagcataggatgtgatgtatacgatgttggagatctacacgttgcgcaagttcctaat
gataaactgtacaacaacactgttaaatacccccgtacagttggccttgcatgtcaaatg
ttggcaaatgaagttagaagagtattagaagctggtcatacttgtgtaactttgggagga
gatcatagtttggcacttggcactattagtggtcatgcccgacagtgttcagatctatgc
gtaatttgggtcgatgcgcatgctgacatcaacaccccactgactacctcatcaggaaat
cttcatggtcagccagtgtcctttctcttgagagagctccaagataaggttccttcgatc
cctgggttttcctggataaaaccgtgcctttccacagcggatatcgtatatattggtttg
cgtgatcttgatgctgctgaacaatttattctaaagaaatataacatcacatactattca
atgaggcaaattgatcgccttggaatacagaaagttatggaaagatcatttgagcagcta
ttgggaagaaaacaaagaccaattcatttaagctttgatatagatgcatttgatccatcc
ttggcggcatctactggaacaccagtaattggaggattaacttatagggagggaatctat
attacagaagaaatacacaatacaggaatgctgtcagccctagatttggtagaagtcaac
ccagctcttggagcctcctctgacgaagtgaaggcaacaacaaacttagcagtagatgtt
attgcttcatgtcttggccaaacaagagaatgcactcaagtaattatagaagagctcccc
acgcctactacagaatttgcaacagaaaatgaagagcaaataaggatttaa

DBGET integrated database retrieval system