KEGG   Nanorana parkeri: 108795727Help
Entry
108795727         CDS       T04897                                 

Gene name
WNK2
Definition
(RefSeq) serine/threonine-protein kinase WNK2
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108795727 (WNK2)
   01009 Protein phosphatases and associated proteins [BR:npr01009]
    108795727 (WNK2)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108795727 (WNK2)
Protein kinases [BR:npr01001]
 Serine/threonine kinases: Other
  Wnk family
   108795727 (WNK2)
Protein phosphatases and associated proteins [BR:npr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108795727 (WNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C zf-PHD-like
Motif
Other DBs
NCBI-GeneID: 108795727
NCBI-ProteinID: XP_018422517
Position
Unknown
AA seq 2116 aa AA seqDB search
MDTAMLSSVKEAQLAPAPKNLKPVKLRFLRRTVVESDQEEPSVLELSESLHQSKVIPISR
ARRAIAKRTQGTSDQGPTPENNEPKTETSQEKITQAPPEQAGQERKDELDTTKETPKSKK
EEEEENEEEADIKAVSTSPDGRFLKFDIEIGRGSFKTVYKGLDTETWVEVAWCELQDRKL
TKVERQRFKEEAEMLKGLQHPNIVRFYDFWESCLKGKKCIVLVTELMTSGTLKTYLKRFK
VMKPKVLRSWCRQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRA
SFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTS
GVKPASFEKVADPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRK
STIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPEDVAQEMIESGFFHENDVKVVAKS
IRDRVALIQWRRERIRPENGETEVLEQMNVPQTTLPPLAHSSHIGQHEGEEMEADQHSFL
PKLPASITSVASDSTFDSGQGSTVYSDSQSSQQSVIYSSLPDTLPPAIQRVYSPPVIEGQ
VLPQSPQHQLGQYQQPAAHGVTATPSMHSGLAQHNYQDLSTAYQVVQPTTASSVQFGAVP
PVLSSQQPVQHQALLQQIPSGQSVCPVPPTSHTYPQYQPPLTPAPPNPLQRNTVPLQQHQ
VPTSQLPPYPLIPAVTPLTGLESLPANLSDLPAVRITPLPAPCQYFPPGVVMPNFSVTPA
GPPSGQSVTPQLVLPYETNLLPNIQVAPIPLLAVATSGMPGLMTPQPPTQHPQSQAYQAS
FQQIIQSDIPSVHLSPSVLPVSQQSHPPLPPQSHHPSITHPPDQTTSGAGNKVIGLSQYK
VDLTTPVGILPVASMSPPVHFPSEISQPLQGQDHLAQPSVPHMPHTEAVLAENQSISYPS
LGISQPESHNLTHIQATRSFTESAYEEQHNQENLPSSTQSFDNYIGSDAASGKEMSDGYE
GIHGSKQDGKPAKKHHRRSSRTRSRQEKTNKPKLTILNVCNTGDKMVECQLETHNHKMVT
FKFDLDGDAPEEIATYMVENEFILQMEKEIFIEQMKDVIDKAEDMLSEDTEGERSSDQGA
SPQQADSKAEMREENQHAQVKTPVYQQNVLHTGKRWFIICPVMESPNSTDVSSVTTKSEH
QSDSTVANAKDEMVCEDGQHKFPTEQYKSISTTGQSISADVGEHATQIPTSLTLSSITQS
SSTISSDLQTQTEMSISTLPESVSFLQGDPATLGASAVFQPVVEVEVAEPHVLSLNEKAT
ARTLAQSEHNTCVSPPDQRYNDKGSNELVHPAQVTHDSGQPHNLPQEKPVKLQPVFYESD
CSSPAVQIKPDTCMAVQCNQTNDGIQVVHEISSASQPVSQTQPLALPVVNSTLQQASMES
DGEGPPRVEYTYDTIKTLDEKLRNLLYQEYTPANMPAGTPENSGTLESTAEVISSQPMNA
DMTPMTGCNTSILYPIESALSAESLSGGSDDCEAPRQRVHAAAQSQRRHSGDQKWKEQSS
LERSPPKKRHHHAEKSKTIGRFSVMSTEDEVTVTSPSYLRFSAPPDVYLDQLPTNFVKPS
VPRAHTSSPINSLFCGHVSSDSDEDEILQPKAKDSAPSTPSKGANEFMKKATAFLHRKAS
VQGPDSPSGQGMKIPTINVTSFHSQSSYVSSDNDSELEDSDMKKELQNLREKHMKEITEL
QVQQRREIEALYVRLGKPLPPNVGFLHAAPPSGRRRRISKNKLKSGKLLNPLVQHLKNGA
SNITAECNGLPAKDPLKSHPDIKGKTAGSSLTASPVRGVQTQQPCSVKVTVSSDNICSGV
VRDGGDVHGSCGQGWTVYHQTSERVTYKSNSKPRTRFLSGPVSLSIWSTLKRLCLGKEHS
NRSSTSSLATGPEPSLVPSLNAQQVQAQSNNSNNKKGTFTDDLHKLVDEWASKTVGAAQF
KPSLNQLKQYQQRLDLEHKPTATPGDQNAGSQPSSDTARKYSASLPCLAPTGLMSTSFPA
ALSGATQSGILPSYMMPLCQYAGVFPAPVYGAQWSGATTPAIAGSQLIAQSASMQIFPMS
MQQPTVKQSGSNLRIT
NT seq 6351 nt NT seq  +upstreamnt  +downstreamnt
atggacactgcaatgctgagctcggtgaaagaagcccagctcgcgccagctccgaaaaac
ttgaaaccggtcaagctgaggttcttgaggcggaccgtggtagagtccgatcaagaggag
ccgtctgttttagaactgagtgaatctctgcaccagagcaaggtcatcccgatctctaga
gccagaagggccattgctaagaggactcaggggaccagtgaccagggacccaccccagag
aataatgaacccaagaccgagacttcccaagagaagataacacaagcaccaccagagcaa
gctggccaagaacgtaaagatgaactggacactactaaagagacaccaaagtccaaaaag
gaggaagaggaggaaaacgaagaagaggcagatatcaaggctgtttctacctcccctgat
ggaaggtttttaaagttcgacattgaaataggaagaggctcctttaaaacggtttataag
ggtctggatacggaaacgtgggtggaggtggcatggtgcgaacttcaggatcgtaaatta
acaaaagttgagaggcagcgatttaaagaggaggcggaaatgctgaaaggtttgcaacat
ccaaacattgtgaggttttacgacttctgggaatcctgcctgaaggggaagaaatgcatt
gtcttggtgactgagctcatgacatcggggacactgaaaacatacttgaaaagatttaag
gtcatgaagccaaaggttctgcgcagctggtgtcggcaaattcttaaaggcttgcacttt
cttcatacgcgaactcctccaataatccatcgggatttaaaatgtgataacatttttata
actgggccaactggctctgtgaagatcggagatctgggcctggctaccttgaaacgagcc
tcttttgctaaaagtgttataggaacccccgagtttatggcacctgaaatgtatgaagaa
cattatgatgaatctgtggatgtgtatgcttttggaatgtgcatgttggaaatggctacc
tcagaatacccgtactctgaatgccagaatgctgctcaaatataccgcaaagtcaccagt
ggggtgaaaccggccagctttgagaaagtggcagaccctgaaatcaaagagataattggg
gaatgcatctgtaagaacaaggaggaaaggtatgaaattaaagacttgctaagccatgct
ttctttgctgaagatacgggggtgagggtggaactggctgaggaagaccatggcagaaaa
tccacgattgccttaagactgtgggtagaagaccccaagaagctgaaaggaaaacccaaa
gataatggagccattgagtttacctttgacctggaaaaggaaactccagaagatgttgcc
caggaaatgattgagtctggatttttccatgaaaatgatgtgaaggtagttgcaaaatca
atacgcgatcgagtggcattaatccaatggagacgagagagaattcggccagagaatggc
gagaccgaggtgctggaacagatgaatgtaccccagaccaccctgccaccacttgcccac
tcttcccacataggtcaacatgaaggagaagaaatggaggcagaccagcactcattcttg
cccaaactacctgccagcatcacttctgtagcatctgacagcacatttgacagtggtcaa
gggtccacggtgtactcagattcacagagcagtcaacaaagtgtaatttactcttccttg
ccagacactctacccccagccatccaacgagtatacagtccacctgtaatcgaaggccag
gttctgccacagtctcctcagcatcaactgggccaataccagcagcctgcagcacatgga
gttactgccacaccttctatgcactctggactcgctcaacataattaccaagacctgagc
acggcgtaccaagttgtgcagccaaccacagcctcgtctgtccagtttggggctgttcca
cctgtattatccagccagcaaccagttcaacaccaagctcttctacagcaaatcccatct
gggcagtctgtctgtcctgtgccacctacctcccatacataccctcagtaccagcccccg
cttacgccggctccaccaaacccactacagagaaatacagtaccattgcaacagcaccag
gtacctacatcacagcttcctccgtatcctctcataccagcagttactcctcttacagga
ctcgagagcctccctgccaatctctctgacttacctgctgtccgtatcacccccctgcct
gctccctgtcagtatttcccaccaggtgtggttatgcccaacttttccgtcactcctgca
gggcccccgtcagggcagtcagtcaccccgcagttggtgctaccatatgagactaatctt
ttgccaaatatccaggttgctcccatacctttactagcagtggcaacatctggcatgcca
ggattaatgaccccacagccgccaacacaacatcctcaatcacaggcgtaccaggcctct
tttcagcagatcattcagagtgatatcccttctgttcatctctccccaagtgttctgcct
gtgtcacaacaatcccatcctcctcttcctcctcagtcacatcatccaagcataacccat
cctcctgatcagactacatctggggctgggaacaaggtcattggtctttcccagtataaa
gtggacttaactacccccgtaggaattttgccggttgcatcgatgtctccacctgtccac
tttccctcagaaatttcccagccattgcaaggacaggatcacctcgcccaaccttctgta
ccacatatgccacataccgaggcagtcttggctgagaatcagagtatatcctatccaagt
cttggcatttcccaacctgagtctcataacctcactcacatccaagctacccggtcattt
acagaatctgcttatgaggagcaacacaatcaagaaaatctgccaagctcgactcaaagc
tttgataattacataggttctgatgccgcctctggtaaagaaatgagtgatggatatgag
ggcatacatggcagtaaacaggatggaaaaccagctaagaaacatcatcggaggtcatcg
cgcactcgctctcgccaggaaaagaccaataagcctaaactaaccattcttaatgtgtgc
aacactggagacaagatggtagaatgccagctagaaacgcataaccacaaaatggttacc
tttaaatttgacttggatggcgatgcaccagaggagattgctacatacatggtggaaaat
gaattcatactgcagatggagaaagagattttcattgagcagatgaaggatgtcatcgac
aaggcagaggacatgctgagcgaagacacggaaggggagagaagctccgatcaaggggca
agtcctcaacaggctgactccaaggcagaaatgagggaggaaaatcaacatgcccaagta
aagacaccagtataccagcaaaacgtcttgcatactgggaagcggtggtttatcatctgc
ccagtgatggagagcccaaactccacagatgtctcttcagtgaccacaaagtcggagcat
caaagtgacagcacagttgctaatgccaaagatgaaatggtctgtgaagatggccaacat
aaattccctactgaacagtacaagtccatctcaaccacaggccagtcaatctccgcagat
gttggtgaacatgctacacaaattcctacttccttgacactgtcctctataacacagtcg
tcatccactatatcatccgatctgcaaactcagactgaaatgtcgatttcaactcttcct
gaatctgtttccttcctgcaaggagatcctgctactcttggtgcatctgcggtttttcag
ccagttgttgaagtggaagtagcagaacctcatgtactgtcacttaatgagaaggcaaca
gcacgcactttggcacaatctgagcacaatacatgcgtgtcacctccagatcaaagatac
aatgacaagggttcaaacgaacttgtccaccctgcacaggtaacccatgatagtggtcaa
ccacacaaccttcctcaggaaaaacctgtgaaacttcagcctgtgttttacgaatcagac
tgcagttcaccagctgtgcaaataaagccagatacttgtatggctgtccagtgtaatcaa
acaaacgatggcattcaggttgttcatgaaatatcatcagcatctcaacctgtttctcag
actcagcctttagctttacctgtggtaaattcaactttgcaacaagcaagcatggagtca
gatggagaaggtccacccagagtggaatatacatatgatacaattaagactttagatgaa
aagctcagaaatctactgtatcaggaatatactccagctaatatgcctgctgggacacca
gaaaattctggaaccctagaaagtacagcagaagttataagctcgcagccaatgaatgca
gacatgactccaatgactggttgtaacacatccatcttgtatccaattgagagtgctcta
tcagcagaatcactcagtggtggctcagatgactgtgaagcaccaaggcaaagggtccat
gctgccgcccaatcacaaagacgccattctggagaccagaagtggaaagagcaaagttct
ttagaacgatctcctcctaaaaagaggcatcatcatgctgaaaagtcgaaaaccattggg
aggttttctgttatgagtacagaagatgaggtcactgtcacatctccgagttatttgagg
ttttctgccccaccagatgtctatctagaccagcttcctaccaactttgtcaagccttct
gtgcctcgagcgcatacttcttcccctataaattctcttttttgtggacatgtgtcaagt
gattcagatgaggatgagattcttcagccaaaggccaaagattctgctccatctacccca
agcaaaggggctaatgaattcatgaagaaagctacagctttcttgcatcgaaaggctagt
gtgcagggcccagattccccaagcggtcaaggcatgaaaatccctacaataaatgtgaca
tcttttcattcacagtcttcctatgtgagcagtgataatgactcggagcttgaggattct
gatatgaaaaaggaattacagaacctcagagaaaagcacatgaaagaaatcacagaactg
caagtacagcagagaagagagatagaagctctttacgtcaggctgggcaagcctctccct
cctaatgtgggcttccttcacgcagcaccaccaagtggccgtcgacggagaatcagcaag
aataaactaaaaagcggaaagttgcttaatcctttggttcagcacctgaaaaacggggca
agcaatatcactgctgagtgtaatgggttacctgccaaggatccacttaaatctcaccca
gatataaagggcaaaactgctggctcctccctcacagcgtccccggttcgtggtgtccag
acgcagcagccttgctcagtgaaggtcacggtgtcatctgacaatatctgttctggtgta
gtccgggatggtggtgatgtgcatggcagctgtggacaaggctggacggtttaccaccaa
acgtctgagagagtgacctataagtctaatagcaaacctcgtacccgattcctcagtgga
cctgtgtctttatccatctggtccactctgaagcggctatgtctaggcaaagagcacagc
aatagatcctcaacaagcagccttgcaacaggccctgaaccatcactagtcccttcacta
aatgcacagcaagttcaggcccagtccaacaatagtaacaacaaaaagggaacatttact
gatgaccttcacaagctggtggatgagtgggcaagcaaaaccgttggagcagcacaattc
aaaccttctcttaatcaactgaagcagtatcagcagcggctggacctggagcacaagcct
acagctacacctggagatcaaaatgcaggaagtcaaccttcttctgacacagccaggaag
tacagcgcttcactgccatgcctagctcccacgggactgatgtccacatcattcccagca
gccctttctggagcaacccagtctggtatattgccatcttacatgatgcccctttgtcag
tatgctggagttttccccgcaccagtgtacggagcccagtggtctggagcaacaacgcct
gccatagcaggaagtcagctgattgcgcaatctgcaagcatgcagattttccccatgtcc
atgcagcaacctaccgtgaaacagtctggttccaacctgaggatcacgtag

DBGET integrated database retrieval system