KEGG   Nanorana parkeri: 108796498
Entry
108796498         CDS       T04897                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
npr  Nanorana parkeri
Pathway
npr00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    108796498 (RDH5)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     108796498 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 PLAC9
Other DBs
NCBI-GeneID: 108796498
NCBI-ProteinID: XP_018423487
Position
Unknown
AA seq 316 aa
MWCLVLLFAIAWAVGWFLRDRQTISRLSDKHVFITGCDTGFGNLLAKRLNRKGFHVLAGC
LTQSGADGLQKACPMGLKTTLLDVTNCESIKKAVEWVKAEVGSKGLYGLVNNAGIANPIG
PTEWMTIEDYRRVMEVNTFGTIGVTLRFLPLVKQARGRIVNMASVLGRISANGGGYCVSK
YAVEAFSDSLRRDIQHFGVKVCIIEPGFFKTAVTDLDCIEKSLQKLWDEMPAETRRSYGD
AYYQKYMKVQRLIMNFICDPDISKVPKCIEHALQARHPRTRYSPGWDAKLVWLPVSYMPS
FIVDAVLAFILPKPEQ
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtggtgcctcgtgcttcttttcgccatcgcatgggcggtcggatggtttctgcgagac
cgacagaccatttcacgactgtctgacaaacatgtctttatcaccggctgtgacacaggc
ttcggaaatctgctggccaagcgactgaacaggaagggtttccacgtccttgcaggatgc
ctcacacagtcaggagcagacggcctgcaaaaagcctgtcctatgggactgaaaaccact
ttgctggatgtcaccaactgtgaaagcatcaaaaaggccgtggagtgggtgaaagcagag
gtgggaagtaaaggtctgtatgggctagtcaacaatgcaggcattgcaaacccaataggc
cctactgaatggatgacaatagaggattatcggagggttatggaggtgaacacatttggc
accattggagtaacattacgttttctacccctggtaaagcaggcacggggcagaattgtt
aacatggccagcgtacttgggaggatatcagcaaacggaggaggttactgtgtctctaaa
tatgctgtggaggctttttcggatagccttagacgggacatacaacactttggtgtaaaa
gtctgcatcatagagcctggcttctttaaaacagcagtaaccgacctggattgcattgaa
aagtctctgcagaagctttgggacgaaatgcctgctgagacaaggaggagctatggggat
gcgtattaccaaaagtatatgaaagtccaaaggctgattatgaacttcatctgtgatccc
gatatctccaaagtgccaaaatgcatcgaacatgccttacaagcaagacacccacgtaca
agatacagcccaggctgggatgcaaagttagtgtggctaccagtttcttacatgccaagt
ttcattgtggatgccgttctcgcctttattcttcctaaaccagaacagtga

DBGET integrated database retrieval system