KEGG   Nanorana parkeri: 108796922Help
Entry
108796922         CDS       T04897                                 

Gene name
HNMT
Definition
(RefSeq) histamine N-methyltransferase
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
npr  Nanorana parkeri
Pathway
npr00340  Histidine metabolism
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    108796922 (HNMT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npr04147]
    108796922 (HNMT)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     108796922 (HNMT)
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108796922 (HNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 PA-IIL Methyltransf_25 NodS Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 108796922
NCBI-ProteinID: XP_018423980
Position
Unknown
AA seq 293 aa AA seqDB search
MEPGMRSLMSDNSRYVESFRLFLQNSTEHQCMQNFIDTKLAAIVSSIGDGKSVVNVLGVG
SGSGEIDFQMLSKIHARYPGVSINNNIVEPSPEQLFSYKERVAKTPGLDHITFHWNKKTS
TEFEVQVKEKEEDKKYDFIHMIQMLYYVKDIPATLKFFTSLLSTEGKLLIILVSGNSGWS
TLWKKYGSRLPLNDMCLYITAGDIADMLSLMGAQYQSYDLQSEMDISECFVEGDRNGELL
LDFLTETCDFKKSAPADLREEIIEDLKSSGCSSIRDSKVIFNNNLSVIVVEKK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgggatgaggagcctgatgtctgacaacagccgatatgtggagtccttccgc
ctcttcctgcagaattctacagagcaccagtgcatgcagaacttcatagacaccaaactg
gctgccattgtgtccagcataggtgacgggaaatcagttgtcaatgtcctcggagtagga
agtggctcaggtgaaattgactttcagatgctctccaagattcatgccaggtatcccggg
gtctccattaataacaatattgttgagcccagccctgaacagttgttcagttacaaagag
cgcgtggccaaaacgcctggcctggatcatataaccttccactggaacaaaaagacctca
acggagtttgaggtccaagtgaaagagaaggaagaggataaaaagtatgatttcattcat
atgattcagatgctgtactatgtcaaggatattcccgcaactttaaaattcttcaccagc
ttactttccacagaaggcaaacttcttataatccttgtatctggaaacagcgggtggtct
acactgtggaagaagtatggatcccgcttgcctctgaacgatatgtgcctgtacatcaca
gcgggggacatcgcggacatgttgagtttgatgggggcccaataccagagttacgacctg
caatccgaaatggacatctcagagtgttttgtggaaggggaccggaatggggagctactt
ctggacttcttaacggaaacctgtgattttaagaagagcgcccccgccgaccttagagag
gagatcatagaggacctgaagagctctgggtgcagctctataagggacagcaaagtcatt
tttaataacaatcttagtgtgattgtagttgagaaaaaatag

DBGET integrated database retrieval system