KEGG   Nanorana parkeri: 108797385
Entry
108797385         CDS       T04897                                 

Gene name
ACY3
Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108797385 (ACY3)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     108797385 (ACY3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 108797385
NCBI-ProteinID: XP_018424474
Position
Unknown
AA seq 312 aa
MPGTVYVDPLHRVAVAGGTHGNEMSGVFLVKHWLKHSSQLERDTVSAVPLLSNPKASEKG
VRYYEKDLNRCFTLDILSAPDSPDDPYEVLRAKEINRLLGPRGSANAYDMILDLHNTTSN
MGVCLIVSRVHNAVEMHACQYIQTHLPHYNPRIYVYAKPGTDLYSVDSVAKCGLGFELGP
QPQGVVRADILQKMKTVIEMTLDFINHLNKGMEFPAFETDTYQCSGQVDFPRSSDGEISA
VIHPSLQDKDFSLLHPGDLIFLTLDGQSIPYSGEKPIYPVFINEAAYYEKKIAFILAEKI
RVSVPALRRQTH
NT seq 939 nt   +upstreamnt  +downstreamnt
atgccgggaacggtctatgtggatccccttcatcgcgtggccgtggcaggcggcacccat
ggcaacgagatgtcgggtgtcttcctggtgaaacactggctcaaacactcttcccagctg
gaaagggacacggtcagcgctgtacctcttctgtccaatccgaaggcatctgaaaaagga
gtgcgctattatgaaaaagacttgaatcggtgcttcactttggacatcttatctgctcca
gactcacctgatgatccatatgaagttttgagagcgaaggagatcaaccggctgttaggc
cccagagggagcgcaaacgcatatgacatgatactggatctacataacaccacctctaac
atgggggtttgcctgattgtcagtagggtccataatgcagtggagatgcatgcctgccaa
tatatacagactcatcttccgcattataatccaaggatatatgtgtacgcgaagcctggg
acagacctctatagcgtggactctgttgccaaatgtggtcttgggtttgagttaggtcct
cagccgcagggggttgtccgtgctgatatactgcagaaaatgaagacagttattgaaatg
actttggactttattaatcacctcaacaaaggaatggagtttccagcttttgaaactgat
acttaccagtgttctggtcaggtggattttccccggtcatcggatggggagatatcagcg
gtcatccatccttccctgcaggataaggatttttcattgctacatcccggtgacctgatc
tttctgactctggatggacagtcaattccttacagtggagagaagccaatttacccggtc
tttattaatgaagctgcttattatgagaagaagattgccttcatactggctgagaagatc
cgggtgtctgtcccagctctgagaagacagacacactaa

DBGET integrated database retrieval system