KEGG   Nanorana parkeri: 108798029Help
Entry
108798029         CDS       T04897                                 

Gene name
MARS
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
npr  Nanorana parkeri
Pathway
npr00450  Selenocompound metabolism
npr00970  Aminoacyl-tRNA biosynthesis
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    108798029 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108798029 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:npr01007]
    108798029 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:npr03016]
    108798029 (MARS)
Enzymes [BR:npr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     108798029 (MARS)
Amino acid related enzymes [BR:npr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   108798029 (MARS)
Transfer RNA biogenesis [BR:npr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    108798029 (MARS)
 Prokaryotic type
   Other AARSs
    108798029 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C GST_C_2 GST_C_3 Anticodon_1 GST_C_6 GST_N Glutaredoxin2_C tRNA-synt_1e LXG
Motif
Other DBs
NCBI-GeneID: 108798029
NCBI-ProteinID: XP_018425231
Position
Unknown
AA seq 910 aa AA seqDB search
MKLFVSEGNPHGVKVLAAAGLWAAQVEIQRLQQEEKVVPFLSQPKLPALELDDGNFLFTS
NAICRCFSLSAEKEPSDLINQWLEWEATELQPSISAALYAHVVQGKKKEEVLQTVNKSLI
YIAQKLTKKAYLAGDALSVADIVVWGAIYPLIVDGASLPEELSSLKSWFKNVTELDQCLK
AAESLLKGQGPSVFKAFLQKLPAPVLVSEKSLSNEQEGEDTPARLLSEEDIAAAAEAWKK
GLAEAPKPKPQQHPILPIEGEKNLLITSALPYVNNVPHLGNIIGSVLSADVFARYCRLRN
WNTLYVCGTDEYGTATETKAMEEGLTPQQICDKYNAVHTAIYKWFNISFDYFGRTTTSHQ
TKIAQEIFHRLLERGFLLKDTVEQLRCETCQRFLADRFVEGTCPLCNYEEARGDQCDKCG
KLINAVELKRPQCKVCKQSPVIKSTEHLFLDLPKLEERLEKWLDQSLATGDWTANARYIT
RSWLRDGLKPRCITRDLKWGTPVPLDGFRDKVFYVWFDAPIGYISITANYTDEWEKWWKN
PEQVQLYNFMAKDNVPFHSVIFPSCLLGVEDNYTVVNHLVATEYLNYEDGKFSKSRGVGV
FGDMAQDTGIPADIWRFYLLYVRPEGQDSAFSWSDLMLKNNSELLNNLGNFVNRAGMFVQ
KFFNGQVPEIELLPEDKKLLAQVTAELQQYNQLLEKVRIRDALRAILNISRHGNQYIQVN
EPWKCIKGTQQEQKRAGTVTGLAVNMAALLSNMLQPYMPTISSVIREQLLMPEEANVLTS
DFRCILQSGHRIGNVSPLFQKLETDQIESLRKRFGGGQLDADSKETQVKAPAPTPEPAKE
TPKVGDPQRIQELTQAVEKQGYHVRELKSKAAEKSLIDSEVQKLLKLKKDLALAEGKSPD
PPAQKGKKKK
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttcgtgagtgaggggaacccgcacggggtgaaggtgctggctgccgccggt
ctttgggccgcacaggtggagatccagagactgcagcaggaggaaaaagtcgttcctttc
ttgtcacagcccaaactgccagcactagagctcgatgatgggaattttctttttacttca
aatgcaatctgtaggtgtttttccttgtctgctgagaaagagccgagtgacctcattaat
cagtggctagagtgggaagctacagagctgcagccatctatctctgctgctttgtatgct
catgtggtgcaggggaagaagaaagaagaggtactacaaacagttaataagtctcttatc
tacattgctcaaaagcttacaaagaaagcataccttgctggtgatgcactgtcagttgct
gatattgtggtttggggagccatataccctctcattgtagatggagcaagcctgccagag
gagctctcatctttaaagagctggtttaaaaatgtaaccgaattagaccaatgtctaaaa
gctgctgaatcgcttctgaaaggccagggtccctctgtgtttaaagcatttctccaaaag
cttcccgcacctgtactggtgtctgagaaatctctctccaatgagcaggagggtgaagat
acacctgcccgattgctgtctgaggaggatattgctgcagctgctgaagcttggaagaaa
ggtctagctgaagctccaaagccaaaaccgcagcagcacccaatcctgcccatagaaggc
gagaaaaacttactgattaccagtgcattaccctatgtgaataatgtccctcacttgggg
aacatcattggctctgtgctcagtgctgatgtctttgccaggtactgtcgactaagaaac
tggaacactctgtatgtgtgtgggacagatgaatatggcacagccactgaaaccaaagca
atggaggaagggctgaccccacagcagatctgtgacaagtacaatgctgtccacactgca
atatacaaatggttcaacatctcctttgactattttggcagaacaacaacatcacaccag
acgaaaatcgctcaggaaatcttccatcgactactggaaagaggcttcttgttgaaagac
actgtggagcagctgcgatgcgagacctgtcagaggttcttagcggatcgttttgtggaa
ggaacatgccctttgtgtaactatgaggaggccagaggggaccagtgtgacaagtgtgga
aaacttatcaatgctgtagagttaaagaggcctcagtgcaaagtgtgtaagcagtctcct
gtaattaaatcaacagagcatcttttcttagacctgcctaagttagaagaacgtctggag
aaatggttagatcagtcccttgcaactggagattggactgccaacgcccgttacataacc
cgttcctggctccgtgatggcttaaagccacgctgtattactagggatctgaagtgggga
acacccgttccattggatggcttcagggacaaggttttctatgtttggtttgatgcccca
ataggctatatttcaattacagccaattatacagatgagtgggagaagtggtggaaaaat
cctgagcaggtccaactctacaacttcatggcaaaggacaatgtccctttccacagtgtc
atttttccatcatgcctcctgggagtcgaggacaactatacagtggtcaaccatcttgta
gccacagaatatttgaactatgaagatggtaagttctccaagagtcgaggagtgggtgtg
tttggtgacatggctcaggacactggtatcccagctgacatttggagattctatctgttg
tatgtgagacctgagggacaggacagtgcattcagctggagtgatctgatgctaaagaat
aactctgagttactgaacaacctgggaaactttgttaacagggcaggcatgtttgtgcaa
aaattcttcaatggccaagttccagagattgagttacttccagaggacaagaaactcttg
gctcaggtcacggcagagctacagcagtacaaccagctgctggaaaaagttcggatccgt
gatgccctgagggctattttgaacatttctcgtcatgggaaccagtatatacaagtgaat
gagccatggaaatgtattaaagggacacagcaagaacagaaacgtgcaggaacagtaaca
ggattggctgtaaacatggctgctttgctttcaaacatgctacagccatacatgccaaca
atcagctccgtcattcgagagcaattacttatgccagaggaagctaatgtattgaccagt
gacttccgctgcatactacaaagtggacatcgcattgggaatgtgagtccactgttccaa
aaactagagactgaccagattgagtccttgaggaaacgctttggaggtggccagctggat
gctgacagtaaagagacgcaggtaaaagcaccagcacccactccagaacctgccaaagaa
acgccaaaggttggtgacccccagagaatacaagagctaactcaggctgtggagaaacag
ggttatcatgtacgcgagttaaagagtaaggctgcagagaagtcactgattgacagtgag
gtgcaaaagctgctgaagctgaaaaaagacttggcattggctgaagggaagtcacctgat
ccacctgcgcagaaggggaagaaaaagaaatga

DBGET integrated database retrieval system