KEGG   Nanorana parkeri: 108798063Help
Entry
108798063         CDS       T04897                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
npr  Nanorana parkeri
Pathway
npr04012  ErbB signaling pathway
npr04020  Calcium signaling pathway
npr04114  Oocyte meiosis
npr04217  Necroptosis
npr04261  Adrenergic signaling in cardiomyocytes
npr04310  Wnt signaling pathway
npr04912  GnRH signaling pathway
npr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108798063
   04310 Wnt signaling pathway
    108798063
   04020 Calcium signaling pathway
    108798063
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108798063
   04217 Necroptosis
    108798063
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108798063
   04916 Melanogenesis
    108798063
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108798063
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108798063
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108798063
Protein kinases [BR:npr01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108798063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaMKII_AD Pkinase Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Motif
Other DBs
NCBI-GeneID: 108798063
NCBI-ProteinID: XP_018425279
Position
Unknown
AA seq 473 aa AA seqDB search
FENIIEELIGGQAKLLQILSAPVLIFMFLFLNRVTGGELFEDIVAREYYSEADASHCIQQ
ILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPG
YLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWD
TVTPEAKDLINKMLTINPAKRIVASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRK
LKYKNFYSFTAARSLLKKPDGVKMNNKTNVITSPKDPNPPLEPQTTVIHNPADGNKESTE
SSNTTIEDEDVKAAKCTENTNSKSHSNESEPSQGNLSSVHSRKQEIIKVTEQLIEAINNG
DFEAYTKICDPGLTSFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLIGE
DAACIAYIRLTQYMDSTGLPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTIPN
NT seq 1423 nt NT seq  +upstreamnt  +downstreamnt
atttgaaaatataatagaggagctgattggtggccaggcaaagctgctccaaattctgtc
tgcgccggttttgatatttatgtttctgtttcttaacagagttactggtggagaattatt
tgaagatatagtagcaagagaatactatagtgaagcagatgccagtcattgtatacagca
gattctagaaagtgtaaatcattgtcatcttaatggcatagttcacagagacctaaagcc
tgaaaatttgctcttagctagcaaatcaaaaggtgcagcagtaaaacttgcagactttgg
actagctattgaagttcaaggagaccagcaagcatggtttggctttgctggaactccagg
atacctatctccagaagttttacgaaaagatccctatgggaaacctgtggatatgtgggc
atgtggtgtgatcctttacattcttctggtgggttatcctccattctgggatgaggacca
acacagactgtaccaacagataaaagctggagcgtatgattttccatcaccagaatggga
tacggtgactcctgaagccaaagatctgattaataaaatgcttacaatcaatccagccaa
acgaatcgttgcctcagaagctctaaaacatccatggatctgccaacgttctacggttgc
ctccatgatgcacagacaggaaactgtagactgtttgaagaagtttaatgcccggaggaa
gttgaagtataaaaacttttattcatttacagcagcacgaagtttactgaagaaacctga
tggagtcaagatgaacaacaaaaccaatgtaataacaagtcctaaagatcccaacccacc
tctggagccccaaactaccgtaatccacaatcctgctgatggaaataaggagtcaacaga
aagctcaaataccactattgaagatgaagatgtgaaagcagcaaagtgcacagaaaacac
aaactcaaagagtcactcgaatgaatctgagccttctcagggcaacctttcatctgtgca
ttcccgcaagcaggaaatcatcaaagttacagaacaactaattgaagctattaataatgg
agattttgaggcctatacgaagatctgtgaccctggcctcacttcatttgagcctgaagc
tctaggaaaccttgtagaaggaatggatttccatcggttttactttgaaaatgctttatc
caagagcaacaagcctatccatacgatcatacttaacccccatgtccatttgattgggga
agatgctgcctgtatagcctatatccgcctgacacagtacatggattccacaggattgcc
aaagaccatgcagtctgaagagaccagagtgtggcatcgtcgtgatggaaagtggcagaa
tgtacattttcaccgttctgggtcaccaacaatacccaactaa

DBGET integrated database retrieval system