KEGG   Nanorana parkeri: 108798298Help
Entry
108798298         CDS       T04897                                 

Gene name
ETNPPL
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
npr  Nanorana parkeri
Pathway
npr00564  Glycerophospholipid metabolism
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108798298 (ETNPPL)
Enzymes [BR:npr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     108798298 (ETNPPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 108798298
NCBI-ProteinID: XP_018425540
Position
Unknown
AA seq 491 aa AA seqDB search
MCELYTKEKIIEMRKKHIGPSCKVFFAKDPIKIVRAKGQYMFDEKGERHLDCINNVAHVG
HSHPEVTKAAGKQMEVLNTNSRFLHDNLVQYAERLTATLPEKLSVCYFVNSGSEANDLAL
RLARQYSGHFDIITLDHAYHGHVTSLIDISPYKFLQLGKEAKKEYVHVAASPDTYRGKYR
EDHPDPGAAYAEEVNNIIREAHHNNRQIAAFIAESMQSCGGQIIPPRGYFQKVAEYIHEA
GGVFIADEVQVGFGRVGKHFWSFQLQGEDFVPDIVTMGKPIGNGHPMSCVVTTRKIAEAF
GATGLEYFNTFGGNPVSCAIGLAVLDVIEKEDLRGNATRVGNYLMELLEEQKQKHQLIGD
IRGVGLFIGVDLVKDRKLRTPATAEAQHIIYKLKEQRILLSADGPHRNVLKFKPPMCFTK
EDAKMVVDAIDELLTVFEKATESKLTNLSGQKANKRKEAKNSQESTNNLPANACRPQRNG
FPITSKRIRTK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagctatacaccaaggagaaaattattgagatgaggaaaaaacacataggacca
tcatgcaaagtattttttgcaaaagatccaataaagattgtacgcgcaaagggacagtac
atgtttgatgaaaaaggagaaagacacctcgattgcataaataatgtggctcatgttgga
catagtcatcctgaggtaacaaaggctgcagggaagcagatggaggtactaaacacaaac
tctagattcttgcatgacaaccttgtccagtacgctgaacgcctgactgccaccctgcct
gagaagctatcagtctgctactttgttaattctgggtcagaggcaaatgacctagctctt
cgcttggcacgacagtactctggccactttgacataataacccttgaccatgcttatcat
ggtcatgtgacatcacttatagacataagtccctataaatttctccagcttggaaaggaa
gccaagaaagaatatgttcatgtggctgcatcacctgatacctaccgaggaaagtacagg
gaagatcatccagaccctggagctgcatatgctgaggaagtcaataacatcatcagagaa
gctcaccacaataatcggcagattgcggccttcattgctgaatccatgcaaagctgtgga
ggtcaaattatcccaccacgtggctacttccagaaagtggcagagtatatacatgaggca
ggtggagttttcatagcagatgaagttcaggtgggatttggccgtgtaggaaagcacttc
tggagtttccagctgcaaggtgaagattttgtgccggacattgttactatggggaaacct
atcggcaatggacatcccatgtcttgtgttgtcacaaccagaaaaattgcggaagccttt
ggagctactggactggagtattttaacacatttggaggaaatccagtttcttgtgctatt
ggtttggctgtgctggatgttattgaaaaggaagatctgcgaggaaatgctaccagagta
ggaaactatctgatggaactactagaggagcagaaacaaaagcatcagctgataggagat
atcaggggagttggactgtttattggagtagacctggtaaaagatagaaaactgaggact
ccagctacagccgaggcgcaacatataatatataagctaaaagaacaaaggatcctgctt
agtgcagacggtccacacagaaatgtactgaagttcaagcctccaatgtgctttactaaa
gaagatgctaagatggtggtagatgctatcgatgaacttcttacagtatttgaaaaagca
actgaaagcaaattaactaatctgtctggacagaaagcaaacaaaagaaaagaagccaaa
aactcacaagagagcacaaacaatttacccgcgaatgcctgcagaccccagagaaatggt
tttccgatcacaagtaaaagaataagaacaaagtag

DBGET integrated database retrieval system