KEGG   Nanorana parkeri: 108799274Help
Entry
108799274         CDS       T04897                                 

Gene name
MRPL22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
npr  Nanorana parkeri
Pathway
npr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:npr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    108799274 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:npr03011]
    108799274 (MRPL22)
Ribosome [BR:npr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    108799274 (MRPL22)
  Bacteria
    108799274 (MRPL22)
  Archaea
    108799274 (MRPL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 108799274
NCBI-ProteinID: XP_018426617
Position
Unknown
AA seq 204 aa AA seqDB search
MAVAITASLWGPLFRIHRGVTAAGSMLSRSCIHTTASLDKHNWEWKNRIVYPPQLPDEPR
RPAEVYHCRRQIKYSPDKLWYLAKLIKGMSIDQAIAQLEFSDKKGAKIMKEVLLEAQELA
VRSHHVEYKSNLHIAESLSGKGTYLKRIRYHGRGRFGIMDKVYCHYFVKLVEGPPPPKEQ
PITGFDQAKDYVQQLRNRTITNSL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccataactgcgtctttgtgggggccattattccggatccatcgaggggtg
acagcagcaggcagcatgctgtcccggagctgtatccacaccactgcttctctggacaaa
cataattgggagtggaagaacagaattgtgtacccgcctcaacttcctgatgagcctcga
aggccagcggaggtataccattgcaggaggcagatcaaatacagcccagacaagttgtgg
tatttggccaagttgatcaaagggatgtctatagaccaagctattgctcagctggaattc
agcgacaaaaaaggagcaaagatcatgaaagaggtcttgcttgaagcccaggagctggct
gtaagaagtcaccatgtggaatacaaatctaacctccatatagctgagtcgctatctggt
aaaggaacgtatctaaagaggattcgttaccatgggcgaggcagattcggcataatggac
aaagtgtactgccattattttgtcaagttggtggagggtcccccacctcctaaagaacaa
ccaatcacaggcttcgatcaggcgaaggactatgttcaacagctgagaaaccgcaccatc
accaattccctgtga

DBGET integrated database retrieval system