KEGG   Nanorana parkeri: 108799423Help
Entry
108799423         CDS       T04897                                 

Gene name
MTHFR
Definition
(RefSeq) LOW QUALITY PROTEIN: methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
npr  Nanorana parkeri
Pathway
npr00670  One carbon pool by folate
npr01100  Metabolic pathways
npr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    108799423 (MTHFR)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     108799423 (MTHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 108799423
NCBI-ProteinID: XP_018426777
Position
Unknown
AA seq 643 aa AA seqDB search
MVNAALIDSSSASCSSSTDSKESSRCSTPVLDLERHERLRDKMRRRIDSGDKWFSLEFFP
PRTASGAVNLLSRFDRMGSGGPLFIDVTWHPAGDPGSDKETSSMIIASTAVNFCGLETVL
HMTCCQQSKEEITRHLQKAKHQGLKNIMALRGDPLGEEWEEEAEGFNYAVDLVKHIRQEF
KDXQLCLFLGYPKGHPEAESYEQDLKHLKEKVDAGADFIITQLFFRAETFLQFLKDCRAI
GITCPILPGIFPIQGYCSLRQLVKLSKLEVPKEITDVIEPIKDNDAAIRNYGIDLAVSMC
RELLDSGEVHGLHFYTLNREVATVDMLRRLGMWQEDPRRPFPWAVSAHPKRRVEDVRPIF
WASRPKSYIHRTREWDDFPNGRWGNSSSPAFGELKDYYLFYLTSKSPRDQLLKMWGEELC
SEESVYEVFTSYLSGNPNKNGHKVTCLPWNDDPLAPETNLVKEQLEKVNKRGILTINSQP
NVNGKPSTDPVVGWGPSKGYVFQKAYLEFFTSSEMVTALTKVLKRYEPRVNYHIVNVHGK
NITNAPDLQANAVTWGIFPGREIIQPTVVDPDSFMYWKDEAFALWIEQWAKLYEEESPSR
MIIQYIHDNYFLVNLVDNDFPLENCLWQVIEDTFQEHDHPTEQ
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacgccgccctcattgacagcagcagcgccagctgtagcagcagtacggattcc
aaggaaagctcccgatgttccacccccgtcctcgacctcgaacgccatgagcgtctccgg
gacaaaatgcgcagacgcatcgactccggagacaagtggttctcgttggagttcttccct
ccgcgcacagccagtggtgccgtcaacctcctctccaggtttgatcgaatgggctccgga
gggcccctctttatcgatgtgacctggcaccccgcgggggaccccggctcggataaagag
acctcctccatgatcatcgcaagcacggctgtcaatttctgcggcctggagacggttctg
cacatgacgtgttgtcagcaaagcaaggaggagatcacgaggcacctacagaaagccaag
caccagggactgaagaatatcatggctcttcgaggggatcccctgggagaggaatgggag
gaagaggcggaaggattcaattatgccgttgacctggtgaaacacatccggcaggagttc
aaagacnggcaattgtgtctttttctaggttatcccaaaggccaccccgaggccgagagc
tacgagcaagatctgaagcacctgaaggagaaggtggacgccggggccgacttcattatc
acacagcttttcttccgggccgagaccttcttacagttcctgaaggactgcagagccata
gggatcacctgccccatcctgcctggtatcttccccatccagggttattgctccttgcgg
cagttggtgaaactctccaagctcgaggttcccaaggaaatcacggatgtgattgaaccc
attaaggacaatgatgctgccatcaggaattacggtattgacctggcggtgtctatgtgc
agggagctgctggacagcggtgaggtgcacgggctgcacttctacaccctgaaccgggag
gtggccaccgtggacatgctgaggcgtctggggatgtggcaggaggaccccaggcggcct
ttcccgtgggctgtcagcgcacatcctaagaggagggtggaggacgtccgtcctatcttc
tgggcctccagaccgaagagctacattcacaggacacgggagtgggacgacttcccgaac
gggcgctgggggaactcatcctctccggcctttggagaattgaaggattattacctcttc
tacctgacgagcaagtcgccacgagatcagttgctgaaaatgtggggagaggagctgtgc
agcgaggagagcgtgtacgaggtcttcaccagctacctgtctgggaatcccaacaagaat
ggacacaaagttacttgcctgccttggaacgatgatcctctggccccagaaaccaattta
gtgaaggaacagctggagaaggtcaacaaaagaggaatcctgaccattaactcgcagcct
aacgtgaacggaaagccctccacggatccagttgtcggctggggccccagcaagggctac
gttttccagaaggcctacctggagttctttacatccagtgagatggtgacggctcttacc
aaagtcctgaagagatacgaacctcgtgtcaactaccatatcgtcaatgtacacggtaag
aacatcaccaacgcccccgacctccaagcaaatgctgtcacgtggggcatctttcccggc
cgcgaaattatccagccaacagtggtcgaccccgacagcttcatgtactggaaggatgaa
gcctttgctctgtggatcgagcagtgggcgaagctctacgaggaggaatcgccgtctcgg
atgatcatccagtacatccacgataactacttcctggtcaacctggtggacaacgacttc
cctcttgagaactgcttgtggcaggtgatagaggacacgtttcaagaacatgaccaccca
acagagcagtga

DBGET integrated database retrieval system