KEGG   Nanorana parkeri: 108801294Help
Entry
108801294         CDS       T04897                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:npr01002]
    108801294 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npr04147]
    108801294 (ABHD12)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108801294 (ABHD12)
Peptidases [BR:npr01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108801294 (ABHD12)
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108801294 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Chlorophyllase2 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 108801294
NCBI-ProteinID: XP_018428732
Position
Unknown
AA seq 386 aa AA seqDB search
MRKRAEAGAREHDGFRATPLDRECRLKNLRIPGTKGHYPQDLDCDSKGMKRFGRRYGLWS
RLRMFLITLVGIYIAIPFLVKICPAIQAQLVFLNLVRFPYFIDLKRPQDQGLNHTCNLYL
KPDEDVSIGVWHTVPAALWKDAQGKDLAWYEEVMSTHYPVILYLHGNAGTRGGDHRVQLY
KVLGSIGFHVISFDYRGWGDSVGSPSETGMTYDALHVFDWIKARSGDNPVYVWGHSLGTG
VATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVVYRYFPGFDWFFLDPITASGI
KFANDENVKFISCPLLILHAEDDHVIPFHLGRKLYNIAAPAKSLRDYKVQFVPFHKDLGY
QHKYIYRSPELRQILKDFFGSAQEQQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagagagccgaggctggggcccgggaacatgacggcttcagggccactccgctg
gacagggagtgtcgcctgaagaacctgagaataccgggtacaaaggggcattatccgcag
gacctggactgcgacagcaaggggatgaagaggttcggcaggcgctatggcttgtggtcc
cggttacgaatgttccttattacactagttggcatctatatagccattccattccttgta
aagatatgtcctgcaatacaagctcagctggtctttttaaatttagtgaggtttccatat
tttattgacttgaaaaggcctcaggatcaagggttaaatcacacctgcaatctttacttg
aagccggatgaagatgtatctattggtgtctggcacaccgttcctgcagcgctttggaaa
gatgctcagggaaaggacctggcgtggtatgaggaagtaatgtctacacactatcctgtc
attctttacctacatgggaatgcaggcacacgaggaggtgatcacagggtacagctatac
aaggtcctcggctcaataggttttcatgtcatttcatttgactacagaggatggggtgac
tcagttggctctccttcagagaccggcatgacctatgatgcccttcatgtctttgactgg
atcaaggccagaagtggggacaatcctgtctacgtctgggggcactctttggggacaggt
gttgccacaaacttggtgcggagattgtgtgaaagagaaacacctcctgatgccttgatt
cttgaatcaccttttacaaatatccgtgaagaggcaaaaagtcatcctttttcagtggtt
tacagatatttcccaggttttgattggtttttccttgatcccatcacagcaagtggcatc
aagtttgccaatgatgaaaatgtgaaattcatatcctgcccactgctgatactccatgca
gaagatgaccatgtgatcccattccacctaggaagaaagctttacaacatcgctgcccca
gcaaagagtttacgtgattacaaagtgcagtttgtccctttccacaaagacctcggatac
cagcataaatacatatataggagtccggaattacgacagatactgaaggatttctttggc
agtgcccaggagcagcaatag

DBGET integrated database retrieval system