KEGG   Nanorana parkeri: 108801812Help
Entry
108801812         CDS       T04897                                 

Gene name
PLK3
Definition
(RefSeq) serine/threonine-protein kinase PLK3
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
npr  Nanorana parkeri
Pathway
npr04068  FoxO signaling pathway
npr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108801812 (PLK3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108801812 (PLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108801812 (PLK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108801812 (PLK3)
   03400 DNA repair and recombination proteins [BR:npr03400]
    108801812 (PLK3)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     108801812 (PLK3)
Protein kinases [BR:npr01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   108801812 (PLK3)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Polo kinases
    108801812 (PLK3)
DNA repair and recombination proteins [BR:npr03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    108801812 (PLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 108801812
NCBI-ProteinID: XP_018429226
Position
Unknown
AA seq 636 aa AA seqDB search
MESACYIQSQPYPGGLVPEPARSVAPSPTKTIRDPLSGRSYTRGRLLGKGGFARCYEMTD
VLTNKCYAVKVIPHSRVAKPHQREKIVNEIELHRELHHKNVVKFSHHFEDGENIYIFLEV
CSRKSLAHVWKARHTLLEPEVRFYLRQIISGLKYLHVRGILHRDLKLGKGTPRGRQYPQS
DRFEMYKRLTICGTPNYLAPEVLYRQGHGPESDIWSLGCVMYTLLCGTPPFETSDLKETY
RCIKQVKYTLPACLSSSAKQLIMGVLKRNPSERLTLDQILDHEFFTKGYTPDRLPPSSCV
MVPDLHPPNPARSLFAKVAKSLFGKGKSKAKKASSEDKDDISKLVTGFVKSSICRQLSYK
TVDGTEVLPVAGHALTGSCSPVETLTEEASGKSVSRSIRGSLVSSDALEDCITASGVMET
ALEVLKDCLSSMPTGEGLPTPLSRHDNFVWVSKWVDYSNKYGFGYQLSNRCIGVLFNNGT
HMVLPANRRSRSPLITRRELLECEGGKPAGQSFFLMGRFMRLKVGVLTHRDFSVQGGDLP
CHEETAQPLLLLLQWVKTEHALLMLFNNGTLQVNFYNDHTKLILSKPHDAHLLTYINRER
NSQTFPLSSLVESGCSLDMYHRLKYTLKLLQQKAQS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagcctgttatattcaatcacagccctatccgggtggcctagtgcccgaaccc
gcccggagcgtagcccccagtccgaccaagacgatccgggaccccctgagcggccggagc
tacacccgagggcgtctgctgggcaagggcggttttgcgcgatgctacgagatgacggac
gttctcaccaacaagtgctacgcggtgaaggtcattccgcacagccgggtcgccaaacct
caccagcgggagaagatcgtcaatgagattgaactccatcgtgagctccaccacaagaac
gtcgtgaaattctcccaccacttcgaggacggcgagaacatttacatcttcctggaggtc
tgcagccgcaagtccttggctcatgtctggaaggctcggcacactctgctggaacccgag
gtccggttttacctgcgacagatcatatcgggcctgaagtacctgcatgtcagaggcatc
ctgcaccgcgacctcaagctgggtaagggaacgccgcgcggccgtcaatatccacaatct
gatcgttttgagatgtataaacgtctaacgatctgcggcacccccaattacctggcgccc
gaagtcctctacagacagggtcacggcccggagtcggatatctggtcgctgggatgcgtc
atgtacacgttgctctgcggcacgccgcctttcgagacttccgacttaaaggagacgtac
cgctgtatcaagcaggtgaagtacacgctgcccgcctgcctctcctcctctgccaagcag
ctcattatgggggtcctgaagcgcaatcccagcgagcggctgacattggaccagatcctg
gatcacgaattcttcaccaagggttacactccagacagactgccccccagtagctgtgtg
atggtcccggacctgcaccccccaaaccccgccaggagcctcttcgccaaagtcgccaag
agcctttttgggaaaggcaaatcaaaagcaaagaaagcttcctccgaggacaaggatgac
atctccaaactggtgacgggttttgtgaagtcctcaatctgccggcagctcagctacaag
actgtggatgggactgaggttttgccagttgctggtcacgctctcaccggtagctgcagc
cccgtggaaacactaaccgaagaggcttctgggaaatctgtgtccagatctattcgtggc
agtctggtcagcagcgatgcgttagaagactgtatcacggcgtccggtgtcatggaaact
gccctcgaggttctcaaagattgcctgtcctctatgccaacaggtgaaggtctgccgact
cccctctcccgacacgacaactttgtgtgggtgagcaaatgggtggattactccaacaag
tacggatttggctatcagctgtccaaccgctgcattggcgtcctcttcaacaacgggacc
cacatggtgctgccagcgaatcgcaggtcacggtcacctctcattactcggagagagtta
ctggaatgcgaaggagggaaacctgccgggcagagtttttttttgatgggacgttttatg
aggttgaaagtcggcgttttgactcaccgagatttctctgttcagggcggagaccttccg
tgtcacgaggagacggcgcagccgctgcttctgctgctgcaatgggtgaagacggagcac
gcgctgctgatgcttttcaacaatggaacgctgcaggtgaatttttacaacgaccacact
aagctgatcctcagcaagccgcacgatgcgcacctcctcacctacataaaccgggagcgc
aattcccagacgttcccgctcagctcgctggtggagagcggctgcagcctggatatgtac
caccgcctgaaatacaccctcaagctgctgcaacagaaagcgcagtcctaa

DBGET integrated database retrieval system