KEGG   Nanorana parkeri: 108804839Help
Entry
108804839         CDS       T04897                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04068  FoxO signaling pathway
npr04114  Oocyte meiosis
npr04218  Cellular senescence
npr04261  Adrenergic signaling in cardiomyocytes
npr04370  VEGF signaling pathway
npr04620  Toll-like receptor signaling pathway
npr04621  NOD-like receptor signaling pathway
npr04622  RIG-I-like receptor signaling pathway
npr04625  C-type lectin receptor signaling pathway
npr04912  GnRH signaling pathway
npr04914  Progesterone-mediated oocyte maturation
npr04933  AGE-RAGE signaling pathway in diabetic complications
npr05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108804839 (MAPK11)
   04370 VEGF signaling pathway
    108804839 (MAPK11)
   04068 FoxO signaling pathway
    108804839 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108804839 (MAPK11)
   04218 Cellular senescence
    108804839 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108804839 (MAPK11)
   04621 NOD-like receptor signaling pathway
    108804839 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    108804839 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    108804839 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108804839 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    108804839 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108804839 (MAPK11)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108804839 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108804839 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108804839 (MAPK11)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108804839 (MAPK11)
Protein kinases [BR:npr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108804839 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 108804839
NCBI-ProteinID: XP_018432242
Position
Unknown
AA seq 361 aa AA seqDB search
MSGRSGFYRQELNKTVWEVPERYQHLTPVGSGAYGSVCSTYDTKTRQKVAVKKLSRPFQS
LVHARRTYRELRLLKHMKHENVIGLLDVFTPSLSVDTFTEVYLVTNLMGADLNNIVKCQK
LTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQTDDEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGT
PNSEFLMKISSEHARRYIESLPYMPQQDLNEVFCGANPLAIDLLKRMLILDSDKRIAASE
ALAHPYFEQYHDPEDEPEAEPYDESTENKERTIDEWKEITYEEVISFKSTDNKIDNLEIE
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccggagcggattttaccggcaagagctgaacaagacggtgtgggaggtaccg
gagcggtatcagcacctcaccccggtgggctcgggggcctatggctctgtctgctccaca
tatgacaccaaaacaagacaaaaggtagcggtgaaaaaattatcccggccgtttcagtca
ctggttcatgcacgacggacttatcgggagctgcgcttgcttaagcacatgaagcatgaa
aatgtaataggtctactggatgtgtttacaccatcattgtccgtggacacttttactgaa
gtgtacctagtaaccaatctaatgggagcagacctgaacaatattgtaaagtgccaaaag
ctgacagatgaccacatccaattcctgatctatcagctgcttcggggcctcaagtatatc
cattcagcggggatcattcatagagacttaaaacccagcaatttagcggtaaacgaagat
tgtgaattaaggattttagattttggactggcaaggcagacagatgacgaaatgactgga
tatgtagcaactaggtggtacagagctccagagatcatgttgaattggatgcactataac
cagacagttgacatttggtcagttggatgcattatggccgagcttttgaagggcaaagct
ctttttccagggaatgactatatcgaccagctgaaaaggataatggaagttgttggaaca
cctaattctgagtttctcatgaaaatttcatctgaacatgctagacggtatattgaatct
ttgccatatatgccacaacaggatctaaatgaggtgttttgtggtgccaatcctctagcc
atagatctgctgaagaggatgctcattctggatagtgacaagaggatcgccgcctctgaa
gcccttgcacacccttactttgaacagtatcatgatccagaagatgagcccgaggctgag
ccttatgatgaatctacagagaataaggagcgcactattgatgaatggaaagaaattacc
tatgaggaggtgattagctttaagtctactgataataaaatcgataacctggaaattgaa
cagtaa

DBGET integrated database retrieval system