KEGG   Nostoc punctiforme: Npun_BF137Help
Entry
Npun_BF137        CDS       T00713                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
npu  Nostoc punctiforme
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like Sugar_tr LacY_symp
Motif
Other DBs
NCBI-ProteinID: ACC85269
CyanoBase: Npun_BF137
CYORF: Npun_BF137
UniProt: B2JBG5
Position
pNPUN02:137127..138359
Genome map
AA seq 410 aa AA seqDB search
MEAHLVKVIATVTRKTFQTIPRNVWVLGFVSLLTDISSEMIHSVLPLFLVSALGADLLTV
GWIEGIAESTASVFKVFSGALSDYLGQRKRLAVAGYGLSTLVKPLFALATSPGWVLMARF
GDRVGKGIRVAPRDAIVADVTDSANRGAAYGLRQSLDTIGAFTGPLIAFMLMSFSGQNFR
LVFWLAVLPGILAVALLAIGVREPSNINSQRQNNPLQWSALQSLGKSYWVLVAVALLFNL
GNSSDAFLLLQAQQAGISASLVPLTLVVMNVAYSLSAYPVGLLSDRIGRLGLLVGGFCVY
ALAYLGFAFVDAPWQVWGLFGLYGLHQGMSQGILLALVADRVPSHLRGTAFGLINLAIGV
ALLPASLLGGILWQTISPKATFIAGSVFAASAIVLLLVFEGGRRKSVGRE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcatctggttaaggtaatagcaacagtgacaagaaaaacttttcaaaccatt
cctcgtaatgtctgggttttgggatttgtcagcttgttaactgatattagttccgagatg
attcattcagtgttgccgttatttctagtttcggcattaggagcagatttactaacagtt
ggctggattgagggaattgcagaatcaactgcttctgtgttcaaagttttttcaggggcc
ttaagcgattatttaggacagcgtaagagattggctgtcgctggttatgggctatctacc
ttagttaaacccctgtttgcattggcaactagtcctgggtgggtattgatggctcgtttt
ggcgatcgcgttggcaagggaatccgtgtagctccccgcgatgcaatagtagcagatgtt
accgatagcgctaatcgtggagccgcctacggtttgcgccagtctctggacaccatcggc
gcatttactgggccactaattgcatttatgttgatgtctttttcaggacagaactttcgt
ctagttttctggttagcggtgcttcccggtatcttagcagtagctcttttagcaattggc
gtgcgggaacccagcaatatcaacagtcaaagacagaataatcctctacagtggtctgct
ttgcaaagtttaggtaaaagctactgggtgctagttgcagttgcgctactatttaatctt
ggtaactctagtgatgcttttttattgctgcaagcacagcaagctggaatatctgcctcg
ctagtaccacttaccctggttgtaatgaatgtagcttactctctcagcgcctatccagta
ggattgctatctgaccgcattggtagattgggactattagtaggtggattttgtgtgtat
gctttagcatatctaggttttgcctttgttgatgctccttggcaggtgtggggactgttt
gggctgtatggactgcatcagggaatgagtcagggcatattgttagcactagtagcagat
agagttccgtcccatctacggggtactgcttttgggttaattaatttggctattggtgta
gcgcttttaccagctagcctgttgggaggtattttgtggcaaacaatcagtccaaaagca
actttcattgctggaagtgttttcgctgcgagtgcaattgtattactgctggtatttgaa
ggcggaagacggaaatcagtaggtagagagtaa

DBGET integrated database retrieval system