KEGG   Nostoc punctiforme: Npun_F1429Help
Entry
Npun_F1429        CDS       T00713                                 

Definition
(GenBank) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
npu  Nostoc punctiforme
Pathway
npu00260  Glycine, serine and threonine metabolism
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01130  Biosynthesis of antibiotics
npu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Npun_F1429
Enzymes [BR:npu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Npun_F1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACC80136
CyanoBase: Npun_F1429
CYORF: Npun_F1429
UniProt: B2IZK6
Position
1751197..1752240
Genome map
AA seq 347 aa AA seqDB search
MSSNLEQFASDNSSGICPEALEYMIRANQGSVPAYGNDEWTQKATDYFRELFEIDCEVFF
TFNGTAANSLSLAALCQSYHSVICHETSHIETDECGAPEFASNGSKLLLAQGKNGKLTPE
SIEAIVTRRTDIHYPKPKVISITQSTELGTLYSIEELLKIKGVAKKYNLKIHMDGARFAN
AVAAMNKSPAEITWKTGVDVLCFCGTKNGMALGEAILFFNKELAEDFDYRCKQAGQLASK
MRFISAPWLGLLETGAWLKNARHANQCAEYLENQLLNIEGVDLMFPREANAVFVKLPEQV
IHTLKANNWQFYTFIGVGGVRFMCSWNTTQSRIDELIDDIKKAIIAI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaacttagaacagtttgcaagtgataattcttctggtatttgcccagaagcg
ctggaatatatgattagagcaaatcaaggtagtgttccagcttatgggaatgatgaatgg
actcaaaaagcaacagattattttcgggaactcttcgaaattgattgtgaagtatttttc
acctttaatggtacagccgcaaattctttatctttagctgccctttgccagtcatatcac
agcgtaatttgccatgaaacatctcacatagaaacagatgaatgtggcgcacctgaattt
gcatctaatggttctaaacttttacttgcccaagggaaaaatggcaagttaacaccagaa
tctatagaggcaattgtcactagacgcactgatattcattatcccaagcctaaagttatt
agtattacccaatcaactgaattaggaactttatattctattgaagaacttctaaaaatt
aaaggagtagcgaaaaagtataatttaaaaattcacatggatggcgctcgttttgcaaat
gcagttgccgctatgaataaaagccctgctgaaattacttggaaaactggagtagatgta
ttatgcttttgtggtactaagaatggaatggcattaggtgaagcaattcttttcttcaac
aaagagttagcagaagactttgattatcgatgcaagcaagcaggtcagttagcgtcaaaa
atgcggtttatttctgctccttggttgggtttattagaaacgggtgcttggctaaaaaat
gctagacatgctaatcaatgtgctgaatatttagaaaatcaactcttaaatatagaaggc
gttgacttgatgtttcccagagaagccaacgccgtatttgtgaaattacctgaacaagtc
attcacaccttaaaagcaaataactggcagttttatacatttatcggtgtgggaggagta
cgttttatgtgttcttggaacacaacacaatctaggattgatgaactgattgatgatatt
aaaaaagcaatcatagctatctga

DBGET integrated database retrieval system