KEGG   Nostoc punctiforme: Npun_F4015Help
Entry
Npun_F4015        CDS       T00713                                 

Definition
(GenBank) transporter, hydrophobe/amphiphile efflux-1 (HAE1) family
  KO
K03296  hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family
Organism
npu  Nostoc punctiforme
Brite
KEGG Orthology (KO) [BR:npu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Npun_F4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF TMEM220 Bunya_G2
Motif
Other DBs
NCBI-ProteinID: ACC82394
CyanoBase: Npun_F4015
CYORF: Npun_F4015
UniProt: B2J6I9
Position
5041379..5044570
Genome map
AA seq 1063 aa AA seqDB search
MFVDFFIKRPIFASVCAIVILLIGLISIPTLPIARFPEISPTQITVTSNYSGASAEVVES
GVTNILERQINGVEGLRYLTSSSSNDGTSTITATFDSSRDKDIAAVDVQNRVSVAQPQLP
DSVQRTGVRVSKESSNILLAIGLYAENREYDNIFLSNYADLYLADALKRVKGVSNAQIFG
ERRYAMRLWLDPSRLANRGLTTKDVANALSEQNLQVGAGRIGQEPAPEGQRYQLDVRAAS
RLAEPAEFEEIVLKTGDDGTLVKLKDVGRAELGAENYSSFLRFRGNDAVGLGIYQVPGSN
ALDVAKGVKDELVRLAPSFPPGLKYQVAFDTTSFVEESMSEVIKTLIEAVVLVVIVIFVF
LQDWRTTLIPALTIPLSLIGTFAFVKVFNFSINSLTLFGLTLASGMVVDDAIVVVEQISR
FIQDKGINPRRAASESMRELFGAVIATSLVLMAVFVPVAFFPGTTGALYRQFALTIAFSI
AISTFLALTLTPSLCALLLRQGQKPSGWLGWIFGKINRFLDWVQNGYKRSLTFLTHIKGI
VIGLFIVSLGMTAWLYTTVPTAFLPDEDEGYFITIIQGPQGVSLQYTSDVIAQVEKEILQ
IPEVLGTFAIGGFGFSGNTANSGIIFTTLKSWDERSKPGQSVQAIIGSLQGKLMAIPEAR
VFPVNPPPIQGLGNFGGFVFQLQDRRGNSGLENLVQSMGKLLGQANQTPGLQAVFSTFAA
DTPQLLVEVDRNKAKSLQVSIDDVFSTLQTALGSQYVNDFNLQQRNYRVYIQADQQFRSN
PKDIGKLYVRSQKNQMVPLSNLVKVTQTVGAQTINHYNLFRSIEINGSAAPGSSSGDAIK
AMEKVAKEVLPAGYGYEWSGTALEEIDSGGLAPIIFGLGIIFVFLVLAAQYENYVDPFII
LLSVPLAIFGALIAQSMRGFANDVYCQIGLVMLIGLASKNAILIVEFANQLREQGLSITK
AVIEASQERLRPILMTAFSTLLGIFPLAVATGAGAGSRQSLGTAVFGGMLIATFLSLFVV
PILYIVIKTTTERFIQPNRHQELQTDAVSLDGKSAVYSTKGEN
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttgacttctttattaagcgaccaatctttgcgtcggtctgcgcgatcgtcata
cttttaatcggattaatcagtattcccacactaccgatcgctagattcccagaaattagt
cccacccaaatcactgtaacttccaactatagcggagctagtgcagaagttgtagaaagc
ggagtgacaaatatcttagaaaggcaaatcaacggggttgagggactaagatatctcact
tccagcagcagtaatgatggtactagtactattacagccacctttgattcatcgcgggat
aaagatattgcggctgtggatgtgcaaaatcgtgtttctgttgcccaaccacaactacca
gattctgtgcagcgcacaggagtgcgggtatcaaaagaatctagcaacattctcttggcg
attggtttatacgctgaaaatagagagtacgacaatatattcttaagcaactatgccgac
ctttacttagcagatgccttaaaaagagtcaaaggcgtgagcaacgctcaaatttttggt
gaacgtcgctatgcaatgcgtctgtggttagatcctagtcgccttgctaatcgggggcta
acgaccaaggatgtagcgaatgctttatccgaacaaaacttgcaagttggtgcagggaga
attggacaagaaccggctcctgaaggacaaaggtatcaacttgatgtgcgtgctgctagc
cgattagcagaaccagcagaatttgaagaaattgtcctcaaaactggagatgatggcaca
ttagtcaagctcaaagatgtcgggagagcggaactgggtgcagaaaactatagttcattt
ctgcgatttcgtggtaatgatgctgtcggtttagggatttatcaagttcctggtagtaat
gccttggatgtggcaaagggagtcaaagacgaactagtgcgattagctccgagttttccc
ccagggctgaaatatcaggtagcttttgacacgacatcctttgtagaagagtcgatgtca
gaagttatcaagactctgattgaagcggtagtgctagttgtaattgtaatttttgtgttc
ttacaagactggcgaactactttaattccagcacttaccattccgctttccttaattggg
acatttgccttcgtcaaagtttttaacttttccatcaatagtttgactttatttggtctg
actttagcatcggggatggtggtcgatgatgcgatcgttgtggtggagcaaatcagccgc
tttattcaggataaaggaattaatcctcgtcgagccgctagtgaatcaatgagggaacta
tttggcgcggttattgccacttcattagtattgatggcggtgtttgtgccagtggcgttt
tttccgggaaccacaggcgcactttatcggcaatttgcgctaacgatcgctttctccatt
gcgatttcaacttttttggctttgaccttgacaccttccttatgtgcgctgctgctgcgt
caaggacaaaaaccttcaggctggctgggttggatttttggaaagattaatcggtttctt
gactgggtacagaatggttataagcgatcgcttaccttcttaacacacatcaaaggtatt
gtgattgggttatttatcgtctctttgggaatgactgcttggttgtacaccacagtacca
acagcttttctacccgatgaagacgaaggctacttcatcaccattatccaagggccacaa
ggggtttcgctgcaatatactagcgatgtgattgcacaggtagaaaaagaaattctgcaa
attccagaagtactggggacttttgcgatcggaggatttggttttagtggtaacacagct
aacagtggcatcatatttaccactttaaaatcttgggacgagcgctcaaaacccggtcaa
tcagtacaggcgattattggcagcttgcaagggaagttgatggcaatcccagaagctaga
gttttccctgtgaatcctccaccaatccagggtttaggtaactttgggggcttcgtcttt
caactgcaagaccgcagaggtaacagtggtttagaaaatctagtccagtcgatgggtaag
ttgctgggtcaggctaatcaaacaccaggattacaagctgtatttagcacctttgccgca
gatacaccacaattgcttgtagaagtagaccgcaataaagccaaatcattgcaagtttct
atagatgatgtcttcagtactttacaaactgctttgggatcgcaatatgtaaatgatttt
aatctccagcagcgtaattatcgggtgtatatccaggcagatcaacagtttcgttccaat
ccaaaagatattggcaaactatacgttcgttctcaaaagaatcaaatggttcctttgagt
aacttagttaaagttactcagactgtgggagcgcaaacgataaatcactataatctgttc
cgctcgattgaaattaatggttccgccgctcctggctctagttcgggagacgcaattaaa
gcaatggaaaaagttgctaaagaagttttaccagccggctatggttatgaatggtcaggg
actgcattagaagaaatagattctggtggtttagcacccataatctttggattaggaata
atttttgtatttttggtactagccgctcaatacgaaaactacgttgacccctttatcatt
ctgttatcagttcctttagctatctttggagcgctgatagctcaatcaatgcggggtttt
gcaaatgatgtttactgtcaaattggtctagtaatgttgatcggtttagctagtaagaac
gcaattttgattgtggaatttgctaatcaattacgagagcaagggctttcgattactaaa
gcagtaattgaggcttcgcaagagcggttacgcccaattttgatgactgctttttctaca
ttattagggattttcccgttagctgttgccacaggtgccggtgcgggaagtcgtcaatct
ttgggaacagcagtttttggtgggatgttaattgcgactttcttgagtttgtttgtagta
ccgattttgtatatcgtcattaagacgacaacagagcgctttatccaaccaaatcggcat
caagaactgcaaacagatgcagtttcattagatggtaaaagtgctgtatattcaacaaaa
ggagagaattag

DBGET integrated database retrieval system