KEGG   Nostoc punctiforme: Npun_F4195Help
Entry
Npun_F4195        CDS       T00713                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, large chain RbcL
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
npu  Nostoc punctiforme
Pathway
npu00630  Glyoxylate and dicarboxylate metabolism
npu00710  Carbon fixation in photosynthetic organisms
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01130  Biosynthesis of antibiotics
npu01200  Carbon metabolism
Module
npu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
npu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
npu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Npun_F4195
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Npun_F4195
Enzymes [BR:npu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Npun_F4195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACC82570
CyanoBase: Npun_F4195
CYORF: Npun_F4195
UniProt: B2J8T2
Position
5263600..5265030
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQSKSGYQAGVKDYRLTYYTPDYTPKDTDLLAAFRMTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYICYVAYPLDLFEEGSVTNVLTS
IVGNVFGFKALRALRLEDIRFPVAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFVAEAINKAQAETGEIKGHY
LNVTAPTCEQMLQRAEYAKELKQPIIMHDYLTAGFTANTTLARWCRDNGILLHIHRAMHA
VIDRQKNHGIHFRVLAKALRLSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYIEQDKS
RGIYFTQDWASLPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEAVVQARNEGRNLAREGNDIIREAAKWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacgaagactcagagcaagtctgggtatcaagccggggttaaagat
tacagactaacttattacacacccgattacacaccaaaagataccgatcttctagctgcg
ttccgcatgacaccccagcctggtgttcctcccgaagaagcaggtgcggctgtagcggct
gagtcttccacaggtacttggacaactgtgtggacagacttgctcaccgacctcgatcgc
tacaaaggtcgttgttatgacatcgaaccagttcccggcgaagacaaccagtacatctgc
tacgttgcttatcctttggacttgtttgaagaaggttctgtaaccaacgtattaacctca
attgtaggtaacgtatttggtttcaaagctctgcgggcacttcgtctagaagatatccgt
ttcccagtagcttatatcaagaccttccaagggcctccacacggtatccaagttgagcgc
gacaagttaaacaaatacggtcgtcctttgctgggttgtaccattaagcccaaattgggt
ctttccgctaagaactacggacgcgctgtatacgagtgcttacgcggtggtttggacttc
accaaagacgacgaaaacatcaactccgcaccattccaaagatggcgcgatcgcttcttg
ttcgtagctgaagctatcaacaaggctcaagcagaaacaggtgaaatcaaaggtcactac
ctcaacgtcaccgctcctacttgcgaacaaatgttgcaacgggctgagtacgctaaagaa
ctcaaacagcccatcatcatgcatgactacctgaccgcaggtttcaccgccaacaccaca
ttggctcgttggtgccgtgataacggtatcttgctgcacattcaccgtgcaatgcacgct
gtaattgaccgtcaaaagaaccacggtatccacttccgtgtattggctaaagccctacgt
ttgtctggtggtgaccacatccacaccggcaccgtagttggtaagttggaaggtgagcgc
ggcatcacaatgggcttcgttgacctgttgcgtgaaaactacattgagcaagacaagtct
cgtggtatttactttacccaagactgggcttctctacctggtgtaatggcagttgcttct
ggtggtatccacgtatggcacatgcccgcgctagtagaaatctttggtgatgactccgta
ctacaattcggtggtggtactctgggacacccttggggtaatgctcctggtgctacagct
aaccgcgtcgccttggaagctgttgttcaagctcgtaacgaaggccgtaacttggctcgt
gaaggtaacgatattatccgcgaagctgccaagtggtctcctgaactagctgttgcttgc
gaactgtggaaagaaatcaagttcgagtttgaagcaatggataccgtctga

DBGET integrated database retrieval system